KEGG   Ruminococcus albus: Rumal_2867Help
Entry
Rumal_2867        CDS       T01387                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ral  Ruminococcus albus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rumal_2867
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rumal_2867
   00052 Galactose metabolism
    Rumal_2867
   00500 Starch and sucrose metabolism
    Rumal_2867
   00520 Amino sugar and nucleotide sugar metabolism
    Rumal_2867
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rumal_2867
   00524 Butirosin and neomycin biosynthesis
    Rumal_2867
Enzymes [BR:ral01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rumal_2867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3224104..3225057
Genome map
AA seq 317 aa AA seqDB search
MKYYIGIDLGGTNIKAGVVSEDFKIVAKASCKTNLPRPGEEICADMAKVALEAVKEAGLT
LDDIEAVGIGTPGTANSEAGVIEYSNNLGFLNFPVVKLMKTHIDKPCYVENDANAAAYGE
YIAGAAKGANDAVCITLGTGVGGGIIINGKIYSGFNYAGAEIGHTVINVDGPQCTCGRRG
CFEVYSSATGLIRMTNEAIAKHPESILKEEADDNGKVSARTAFNAMRKGDAVAKQVVDDY
IRYLACGIANTINIFQPDILCIGGGVCNEGDPLLLPLKELVAKEVYTRNSEKNTEIVIAK
LGNDAGIIGAAFLGLNK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattacattggtatcgaccttggaggcaccaacatcaaagcaggtgttgtaagc
gaggatttcaagatagttgccaaagcaagctgcaagaccaacctccccagacccggtgag
gagatatgcgctgatatggctaaggtagcccttgaagctgtcaaggaagcaggacttacc
cttgacgatatcgaagctgtaggcatcggtacccccggtactgcaaattccgaggcaggt
gtgatcgagtattccaacaatctgggattcctgaactttcctgttgtaaaactgatgaaa
acacatatcgacaagccctgctatgttgaaaacgatgctaacgcagctgcatacggcgag
tatatcgcaggtgctgcaaagggcgctaacgacgcagtatgcatcaccctcggcacaggc
gtgggcggcggtataatcataaacggcaagatatactcgggcttcaattacgcaggcgcc
gagatcggtcatacagttataaacgttgacggtcctcagtgtacctgcggaagaagagga
tgctttgaggtatattcctctgcgaccggacttatccgcatgaccaacgaagccatcgca
aaacaccccgagagcatactgaaagaagaggctgatgacaacggcaaggtatctgcaaga
acagccttcaatgccatgagaaagggcgatgctgttgcaaagcaggtagtcgatgattac
atcaggtacctcgcctgcggtatcgcaaacaccataaatatcttccagccagatatactc
tgcataggcggaggcgtatgcaacgagggcgatcctctgctgctgcccctcaaggagctg
gtagctaaggaagtatacacaagaaattccgaaaagaacaccgagatagttattgccaag
cttggcaacgatgcaggtataatcggtgcggctttcctgggtcttaacaaataa

DBGET integrated database retrieval system