KEGG   Ruminococcus albus: Rumal_2954Help
Entry
Rumal_2954        CDS       T01387                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ral  Ruminococcus albus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ral01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ral00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3322319..3323173)
Genome map
AA seq 284 aa AA seqDB search
MSYLKDKKRVVVKVGTSTLTHRTGRLNIRRVEGLVKNLADLQNAGHEIILVSSGAIGLGM
SKIGLVERPKDTPTKQACAAVGQCELMYLYDKLFAEYSINVAQLLLTKFVLLEDRRQNVQ
NALERVIQLGAIPIVNENDTVAIDELELEVGENDSLAATVAKIANADLLIIMSDIDGLYD
ADPRLDPDAKLIPVVEELTDDIRKLAGGAGTKMGTGGMITKINAAEIAVNSGIDMIILNG
KNPDNLYYLFETGSLGTRFKAKGSPDEKKVPAVDESSDSDIVEE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatttaaaagataagaaaagagttgtcgtaaaggtggggacatccacacttaca
caccgtacgggaagacttaacataaggcgtgtggaaggtctggtaaagaatctggcagac
ctgcagaatgcgggacatgagataatactcgtgtcaagcggcgctatcggtctgggtatg
tccaagataggtctggtggaacgaccaaaggatacccccacaaagcaggcgtgtgcggct
gtgggtcagtgcgagctgatgtatctttacgacaagctttttgctgaatacagcataaat
gtggcacagcttctgctgacaaagttcgtgctgttagaggacagaagacagaacgttcag
aacgctctggaaagagttatacagctgggcgctataccgatagtcaacgagaatgacact
gttgctatagacgaacttgaactcgaagtaggcgagaacgattctctggcggctaccgtg
gctaagatagcaaatgcagatctgctgataataatgtccgatatcgacggactttacgat
gccgatccgcgccttgaccccgatgccaagctgatacccgtagttgaagaactgaccgac
gatatcaggaaactggcaggcggtgcaggcaccaagatgggtacaggcggtatgataact
aagataaatgcagccgagatcgctgtgaacagcggcatagatatgataatcttaaacggc
aagaaccccgataatctgtactacctgtttgaaacaggtagtctgggcacaaggttcaag
gctaagggttcacctgacgagaaaaaagtgcctgctgtcgatgaaagcagtgacagcgat
atagttgaagaatag

DBGET integrated database retrieval system