KEGG   Ruminococcus albus: Rumal_2954Help
Entry
Rumal_2954        CDS       T01387                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ral  Ruminococcus albus
Pathway
ral00330  Arginine and proline metabolism
ral00332  Carbapenem biosynthesis
ral01100  Metabolic pathways
ral01130  Biosynthesis of antibiotics
ral01230  Biosynthesis of amino acids
Module
ral_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rumal_2954
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Rumal_2954
Enzymes [BR:ral01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Rumal_2954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ADU23420
JGI: Rumal_2954
UniProt: E6UJ72
Position
complement(3322319..3323173)
Genome map
AA seq 284 aa AA seqDB search
MSYLKDKKRVVVKVGTSTLTHRTGRLNIRRVEGLVKNLADLQNAGHEIILVSSGAIGLGM
SKIGLVERPKDTPTKQACAAVGQCELMYLYDKLFAEYSINVAQLLLTKFVLLEDRRQNVQ
NALERVIQLGAIPIVNENDTVAIDELELEVGENDSLAATVAKIANADLLIIMSDIDGLYD
ADPRLDPDAKLIPVVEELTDDIRKLAGGAGTKMGTGGMITKINAAEIAVNSGIDMIILNG
KNPDNLYYLFETGSLGTRFKAKGSPDEKKVPAVDESSDSDIVEE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatttaaaagataagaaaagagttgtcgtaaaggtggggacatccacacttaca
caccgtacgggaagacttaacataaggcgtgtggaaggtctggtaaagaatctggcagac
ctgcagaatgcgggacatgagataatactcgtgtcaagcggcgctatcggtctgggtatg
tccaagataggtctggtggaacgaccaaaggatacccccacaaagcaggcgtgtgcggct
gtgggtcagtgcgagctgatgtatctttacgacaagctttttgctgaatacagcataaat
gtggcacagcttctgctgacaaagttcgtgctgttagaggacagaagacagaacgttcag
aacgctctggaaagagttatacagctgggcgctataccgatagtcaacgagaatgacact
gttgctatagacgaacttgaactcgaagtaggcgagaacgattctctggcggctaccgtg
gctaagatagcaaatgcagatctgctgataataatgtccgatatcgacggactttacgat
gccgatccgcgccttgaccccgatgccaagctgatacccgtagttgaagaactgaccgac
gatatcaggaaactggcaggcggtgcaggcaccaagatgggtacaggcggtatgataact
aagataaatgcagccgagatcgctgtgaacagcggcatagatatgataatcttaaacggc
aagaaccccgataatctgtactacctgtttgaaacaggtagtctgggcacaaggttcaag
gctaagggttcacctgacgagaaaaaagtgcctgctgtcgatgaaagcagtgacagcgat
atagttgaagaatag

DBGET integrated database retrieval system