KEGG   Ruminococcus albus: Rumal_3171Help
Entry
Rumal_3171        CDS       T01387                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ral  Ruminococcus albus
Pathway
ral00480  Glutathione metabolism
ral00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Rumal_3171
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rumal_3171
Enzymes [BR:ral01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Rumal_3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADU23635
JGI: Rumal_3171
UniProt: E6UFW1
Position
3558542..3559081
Genome map
AA seq 179 aa AA seqDB search
MSIYENKLKMRDGSEYSLEELKGKVLLIVNTATGCGFTPQYKGLEDLYENYRDKGLEILD
IPCDQFGHQAPGDDNEIHEFCTMKYDTKFPRFAKSEVNGENELSLYTFLKSEMAEDSVNG
LKNKTIMKGVEKLSTTCKNKGDIKWNFTKFLVDRQGNVVGRYSPTTKPEDLEEEIKKYI
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatctatgaaaacaaactgaaaatgagagatggaagcgagtatagtcttgaggaa
ctgaaaggcaaggtcttgctgatagtaaatacagccaccggctgcggctttactccgcag
tataaaggtctggaggatctgtatgagaactaccgtgacaagggtctggagatacttgat
atcccctgcgaccagttcggtcatcaggcacccggcgatgacaatgagatacacgagttc
tgcaccatgaagtatgacacaaagttccccagatttgcaaagtcagaggtaaacggtgaa
aatgaactttcgctgtacactttcctgaaatccgagatggctgaggacagcgtgaacggt
ctgaaaaacaagaccataatgaagggcgttgaaaaactcagcaccacctgcaaaaataaa
ggcgacatcaagtggaatttcactaaattcttagttgaccgtcagggaaatgtagtaggc
agatattcacctaccacaaagcccgaagaccttgaagaggagatcaagaaatatatatga

DBGET integrated database retrieval system