KEGG   Ruminococcus albus: Rumal_3401Help
Entry
Rumal_3401        CDS       T01387                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ral  Ruminococcus albus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rumal_3401
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rumal_3401
   00620 Pyruvate metabolism
    Rumal_3401
   00650 Butanoate metabolism
    Rumal_3401
  Lipid metabolism
   00071 Fatty acid degradation
    Rumal_3401
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rumal_3401
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rumal_3401
   00626 Naphthalene degradation
    Rumal_3401
Enzymes [BR:ral01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rumal_3401
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Rumal_3401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRUMAL01:139618..142335
Genome map
AA seq 905 aa AA seqDB search
MAKKEYEIVDGVEKLEAALERVRAAQRKMATFTQEQVDRIFLAAATAANRARIDLAEQAV
AETGMGIVEDKVIKNHYASEYIYNKYRDTKTCGVLEEDKSAGIKKIAEPIGVIGAVIPTT
NPTSTAIFKSLIALKTRNGIIISPHPRAKESTIAAAKVVLEAAVEAGAPEDIIAWIDIPS
LEMTNMLMKEVDIILATGGPGMVHAAYSSGKPALGVGAGNTPAIIDESADILLAVNSIIH
SKTFDNGMICASEQSVIVLDSIYDAVKTEFAARGCYFLKPDELNKVRKTIIINGALNAKI
VGQSAAKIAELAGVTVPEGSKILIGEVESVDISEEFAHEKLSPVLAMYKASDIQDAFGKA
EHLIADGGYGHTASIYLDAVREQEKLSEFGERMKTCRILVNTPSSQGGIGDLYNFKLAPS
LTLGCGSWGGNSVSENVGVKHLLNIKTVAERRENMLWFRAPEKVYFKKGCLPVALDELKN
VMGKKKAFIVTDSFLFKNGFTKPVTDKLDEMGIVHETFSDVAPDPTLACAVEGVKAIRSF
EPDVIIAIGGGSAMDAAKIMWVMYEHPEADFMDMAMRFVDIRKRIYTFPKMGEKAYFICV
PTSSGTGSEVTPFAVITDDKTGHKYPLADYELMPNIAIVDTDMMMSAPKGLTAASGLDCM
VHDLEALVSVMATPFTDGIALESLKMTFDNLPECVENGQTAVRARENMAHAATMAGMAFA
NAFLGIGHSLAHKLGAYHHLPHGICCALVISEVIRFNASDVPVKMGTFPQYEYPQAAAKY
ARIARYLGVQGSGDNELVEGLIAKIEELKEAVGCKKTIAEYGISEEDFLATLDKMSRDAF
DDQCTGANPRYPLISELKQIYMNVYYGRTFTETEKPDASQIDSSESSKDFKQAFNRAASS
GKKRV
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaagaatacgagatcgttgacggtgttgaaaagctggaagccgcccttgaa
agagtaagggcagcacagagaaaaatggcaacatttactcaggagcaggtagacaggata
ttcttagctgctgccaccgcagcaaaccgcgcaagaatagatcttgctgagcaggctgtt
gcagaaacgggtatgggtatcgttgaggacaaggtcatcaagaatcactatgccagcgaa
tacatatacaacaagtaccgcgataccaagacctgcggtgttcttgaagaggataaatca
gcaggcataaagaagatagcagagcctatcggcgttatcggagcggtaatacctactacc
aatcctacttccactgcgatattcaagtctcttatcgcactgaagaccagaaacggtatc
atcatcagccctcacccacgtgcaaaggagagcaccatagcagcagcaaaggttgtactt
gaagcagctgtcgaagcgggcgctccagaggatatcattgcatggatagacatacccagt
cttgaaatgacaaatatgctgatgaaagaagtagatatcatactcgctaccggcggtccc
ggaatggtacacgctgcatattccagcggtaagcctgcactgggcgtaggtgcgggaaat
actcctgctatcattgatgaaagtgcagatatattgcttgctgtaaactctatcattcat
tccaagactttcgataacggcatgatatgcgcttccgagcagagcgttatcgtacttgac
agcatatacgatgcagtaaagacagagttcgctgcaaggggctgttacttcctcaaaccc
gatgaactgaacaaggtaagaaagaccatcatcataaacggtgcgctcaatgcgaagata
gttggacagtctgccgctaagatagctgaacttgcaggcgtgacagttcccgagggttca
aagatacttataggtgaagttgagagcgttgatatctccgaggagttcgcccatgagaaa
ctctctccggtacttgctatgtataaggcttccgatattcaggatgctttcggcaaagca
gaacatcttattgctgacggcggatacggacacactgcttccatatatcttgatgcggta
agggaacaggaaaagctttccgagttcggtgaaagaatgaagacctgccgaattcttgtg
aatacaccatcttctcagggcggtatcggtgacctttataacttcaaacttgcgccatca
cttaccctcggctgcggttcatggggtggaaactcggtaagtgagaatgtaggagtaaag
catctgctcaatataaaaacagttgccgaaaggagagagaatatgctttggttcagagcg
cccgagaaggtatatttcaagaaaggctgcctgcctgttgctcttgatgaactgaaaaat
gtgatgggcaagaagaaagcattcatcgttactgacagttttctcttcaagaacggattc
actaagcctgtaacagataagcttgacgaaatgggtatagtacacgagacattctccgat
gttgctcccgatccgacacttgcctgtgctgtggagggcgtaaaggctatcagaagtttt
gagcctgatgtgatcattgctatcggcggcggttctgctatggatgctgctaagataatg
tgggtaatgtatgagcatcccgaagctgactttatggatatggcgatgcgttttgttgat
atcagaaaaagaatatacacattcccgaaaatgggtgaaaaggcatatttcatatgcgtt
cctacttcttccggtacaggttctgaggtaacaccttttgctgttatcaccgatgacaag
acaggtcacaagtatcctcttgcagattacgaacttatgccaaatattgcaatagttgat
accgatatgatgatgagtgctccaaagggacttactgctgcatccggtctggactgcatg
gtacacgaccttgaagcactggtatcagtaatggctacaccgtttactgatggtatcgct
ctcgaatcgctgaaaatgacctttgataatctgcccgaatgtgttgagaacggtcagaca
gctgtaagggcaagagaaaatatggctcatgcggctactatggcaggtatggcatttgct
aatgcattcctgggtatcggtcactcactggcacataagctgggtgcatatcaccacctg
cctcacggtatatgctgtgcgttggtgattagcgaagttataagattcaatgcttctgat
gttcctgttaagatgggtacattcccacagtacgaatatcctcaggctgccgctaagtat
gctaggatagcaagatatctcggtgtacagggcagcggcgacaatgaacttgtcgaaggt
cttattgcaaagatagaagaactcaaagaagctgtgggctgcaagaagactatcgctgag
tacggtatctccgaggaagacttcctcgctactcttgataagatgtcaagagatgcattt
gatgaccagtgtacaggtgctaaccccagatatcctctcatcagcgagctgaagcagata
tatatgaacgtatactacggcagaactttcactgagactgagaagcccgatgctagccag
atagacagttctgaaagcagcaaggatttcaagcaggcattcaaccgtgcagcaagcagc
ggcaaaaaaagagtataa

DBGET integrated database retrieval system