KEGG   Ruminococcus albus: Rumal_3854Help
Entry
Rumal_3854        CDS       T01387                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ral  Ruminococcus albus
Pathway
ral00521  Streptomycin biosynthesis
ral00523  Polyketide sugar unit biosynthesis
ral01130  Biosynthesis of antibiotics
Module
ral_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rumal_3854
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rumal_3854
Enzymes [BR:ral01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rumal_3854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADU24278
JGI: Rumal_3854
UniProt: E6UKT2
Position
pRUMAL02:complement(180693..181277)
Genome map
AA seq 194 aa AA seqDB search
MGQIKVQKNVGGIEGLCVIEPAVHGDNRGYFMETYNQKDMEAEGLNYTFVQDNQSSSTKG
VLRGLHYQFNHPQDKLVRVIRGEVFDVAVDLRKGSKTFGKWFGIKLTEENKKQFLIPKNF
AHGFIVLSDEAEFCYKVTDFWYPNDEGGLMWNDPTIGIEWEMPEGMTDADLNLSEKDTKN
LSFNEYCEKEGITL
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgggacagataaaagttcagaaaaatgttggtggtatcgaagggctgtgtgttattgag
cctgccgtccatggtgacaatcgtggttacttcatggagacatacaatcagaaggacatg
gaagctgagggactgaactacacatttgttcaggacaatcagtcaagctccacaaagggc
gttctgagaggacttcactatcagttcaaccatccgcaggataagcttgtcagagtaata
aggggcgaggtatttgatgttgctgttgaccttagaaaaggtagcaaaacttttggcaag
tggtttggcattaagctgaccgaagaaaacaagaagcagttccttatcccgaagaatttc
gctcacggcttcatcgtactcagtgacgaggctgaattctgctacaaggttacggacttc
tggtatcctaatgatgaaggtggtttgatgtggaatgatccgacaatcggtatcgaatgg
gaaatgcctgagggtatgacagatgctgacctgaatctttcagaaaaggatacaaagaat
ctttcgttcaatgaatactgtgaaaaagagggcataacgctctga

DBGET integrated database retrieval system