KEGG   Ruminococcus albus: Rumal_3958Help
Entry
Rumal_3958        CDS       T01387                                 

Definition
pyridoxal-phosphate dependent TrpB-like enzyme
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ral  Ruminococcus albus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ral01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ral00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ral00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRUMAL02:324319..325686
Genome map
AA seq 455 aa AA seqDB search
MATNIPYKTYLEESEMPKQWYNVRADMKNKPAPLLNPQTLKPMTAEELGVVFCDELVQQE
LNTTDAYIDIPEEIREFYKMYRPSPLVRAYCLEKALGTPAKIYYKFEGNNTSGSHKLNSA
IAQAYYAKKQGLKGVTTETGAGQWGTALSMACSYFDLDCKVFMVKVSYEQKPFRREVMRT
YGASVTPSPSETTNVGKKILAEHPGTSGSLGCAISEAVEVAVGTEGYRYVLGSVLNQVLL
HQSVIGLESKAAFEKLGVKPDIIIGCAGGGSNLGGLIAPFMGQKLRGEADYRFIAVEPAS
CPSLTRGKYAYDYCDTGMVCPLAKMYTLGSGFIPSANHAGGLRYHGMSSTLSQLYDDKLM
EAVSVEQTKVFEAAQQFARVEGILPAPESSHAIRVAIDEALKCKETGEEKTIFFGLTGTG
YFDMVAYQKFNDGLMTDYIPTDDDLAKGFAGLPKV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccaatataccttacaaaacttatctcgaagaaagtgaaatgccaaagcagtgg
tataatgtcagagctgatatgaagaacaagcctgctcccctgctcaatccccagaccctc
aaacccatgaccgcagaggaactgggcgtagtattctgtgatgaactggtacagcaggaa
ctgaacaccactgatgcttacatagatatccccgaggagatacgcgagttctataagatg
tacagaccctcacctctggtaagggcttactgccttgaaaaagctctgggtactcccgca
aagatatactacaagttcgagggcaacaacacctccggcagccacaagctcaacagtgct
atcgctcaggcttactatgcaaagaagcagggtctgaagggcgtgaccacagaaacagga
gcaggtcagtggggtactgcgctttcaatggcttgttcatattttgacctggactgcaaa
gtgttcatggtaaaggtaagctatgagcagaagcctttccgccgtgaggtaatgcgtacc
tacggtgcttccgtaacaccttcaccctctgagaccaccaacgtaggcaagaagatactt
gctgaacaccccggcacttcgggaagccttggctgcgctatttccgaggcagtagaagtt
gctgtcggcactgagggctaccgttacgtactgggctccgtactcaatcaggtactgctg
caccagtcggttatcggtctggagagcaaggctgcttttgagaagctgggcgttaagcct
gatatcatcatcggctgcgcaggcggcggctccaatctcggcggacttatcgcgcctttc
atgggtcagaagctccgcggcgaagctgactaccgtttcatagcagttgaacctgcatcc
tgccccagccttacacgcggcaagtacgcttatgactactgcgatacaggtatggtttgc
ccccttgctaagatgtacactctgggcagcggtttcataccctctgcaaaccacgcaggc
ggtctgagatatcacggcatgagcagcacactttctcagctgtatgatgacaagctgatg
gaggctgtaagcgttgagcagactaaggtatttgaggctgcacagcagtttgcacgtgtt
gagggaatactccccgcacccgaatccagccacgctatccgcgtagctatcgacgaagca
ctcaagtgcaaggaaaccggtgaggaaaagaccatcttcttcggtcttacaggtacaggc
tacttcgatatggtggcttaccagaagttcaatgacggtctgatgaccgactatataccc
accgatgatgatctggcaaagggctttgcaggtctgcctaaggtataa

DBGET integrated database retrieval system