KEGG   Candidatus Rickettsia amblyommii: MCE_00745Help
Entry
MCE_00745         CDS       T01787                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ram  Candidatus Rickettsia amblyommii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ram00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MCE_00745
   00670 One carbon pool by folate
    MCE_00745
Enzymes [BR:ram01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MCE_00745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
105464..105799
Genome map
AA seq 111 aa AA seqDB search
MGRKTFDSIPPKILKNCICIVFSRNTPLQSYNNIFFIKSLDDFWQVIKPFTDKKIFMVGG
AEIATLFLEQNLIDEFLLTKINKNYDGDTFFPLNILAEWHSVIIDKTLSDL
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgggacgaaaaacctttgactctatacctccaaagattttaaaaaattgtatttgtatt
gttttttcaagaaatacaccattacaatcttataataatatattttttattaaatcttta
gatgatttttggcaggtaataaaaccttttactgataagaaaatttttatggttggaggg
gcagaaatagcgactcttttcctagagcaaaatcttattgatgaatttttacttacaaaa
ataaataaaaattatgatggagatactttttttcctcttaatattttagcagaatggcat
tctgtaataatagataaaacattatcagatttataa

DBGET integrated database retrieval system