KEGG   Candidatus Rickettsia amblyommii: MCE_01280Help
Entry
MCE_01280         CDS       T01787                                 

Definition
3-deoxy-D-manno-octulosonic-acid transferase
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
ram  Candidatus Rickettsia amblyommii
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:ram00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
212432..213826
Genome map
AA seq 464 aa AA seqDB search
MMLLYYALSFILLPVYFIIILIRLLIGKEDIRRIQERFAIGKHRQDDSLDFVQMSANKEA
FKGDTSLRTTAYTLVREDEGLGSTYKLPLEASYARRLIWIHAASVGESMAALTLIHNISK
RYPDVRFLVTSWTNSSAKILTAKLPKIAVQQFLPIDNIIFTRKFLRNWQPDLGIFIESEL
WPCTINEGAKQCKLLLVNARISDKSFKAWLKRKSFFQLILKNFSKIIVQSECDLQKFNEL
GVSDAVNLGNIKFANEKLPVNQEALSKLSLHLDNRRVVLFASTHPEDEEVILPIIKNLKE
QFLDCYIILIPRHPERVKSIIDNCKSHNLSATAKSQNDLPVLSDDLYIVDRFGEMGLFFS
VATISFIGGSFKQGGHNILEAAYFSNCIIFGPDMSKNTDIAKGVLQNESAIQIKNGEDLL
TKLTYLLRSNNSLELKAYRGNALKFVKDNQKVLDEYLKVITKFL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatgttattatattatgctttaagctttatattattacctgtttattttatcataatt
cttatacgtttattaataggtaaagaagatataagacgcatccaagagcgttttgctatt
ggcaaacacagacaagacgattcattagacttcgtgcaaatgtccgctaataaagaggca
tttaaaggagacacttcactgcgaaccacagcgtacacactagtacgtgaggatgaaggg
ttaggatcgacgtataaattacctttagaagcaagttatgcacgaaggctgatatggatt
catgcagcaagcgttggcgagtctatggcagctttaacattaatacataatataagtaaa
cgctaccctgacgttcgttttctagtaacttcttggactaacagctctgctaaaatatta
actgccaaattacctaaaatagcagttcagcaatttttaccgatagataatattattttt
actcgaaaatttttaagaaattggcaacctgatttaggcatttttatagaatcggaacta
tggccgtgtactattaatgagggcgcaaagcagtgtaaattactactagttaatgctcgt
atttctgataaatcgtttaaagcttggctaaaaagaaaaagcttttttcagcttattctt
aaaaatttcagtaaaattatcgtgcaaagtgagtgtgacttacaaaaattcaatgaactt
ggcgtatcagatgcagtgaatttaggcaatattaaatttgccaacgaaaaacttccggtc
aatcaagaagcgttatcaaaattaagcttacatttagacaataggcgagtcgtgctattt
gccagcactcaccccgaagatgaagaggtgattttgcctataatcaaaaacctaaaagag
cagtttttagactgctatattatcttaattccaagacatcctgagcgagttaaatcaatt
atcgataattgtaagtcacataatttatccgctaccgctaagtcgcaaaatgatttacct
gttttaagcgatgatctttatatagttgataggttcggcgaaatgggactatttttttct
gtagctacaatttcttttatcggtggttcttttaaacaaggcgggcataatattttagaa
gcggcatatttctctaattgtattatattcggtcccgatatgagcaaaaacaccgatatc
gctaaaggcgtactgcaaaatgaatcagctatccaaatcaaaaacggtgaagatttacta
accaaactaacatatctactcaggtctaataattctctagaacttaaagcttaccgcgga
aatgctttaaaatttgttaaggacaaccaaaaagtcctagatgaatatttaaaagtaatt
acgaagtttctttga

DBGET integrated database retrieval system