KEGG   Candidatus Rickettsia amblyommii: MCE_01280Help
Entry
MCE_01280         CDS       T01787                                 

Definition
3-deoxy-D-manno-octulosonic-acid transferase
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
ram  Candidatus Rickettsia amblyommii
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ram00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    MCE_01280
Enzymes [BR:ram01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.12  lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     MCE_01280
    2.4.99.13  (Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     MCE_01280
    2.4.99.14  (Kdo)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase
     MCE_01280
    2.4.99.15  (Kdo)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase
     MCE_01280
Glycosyltransferases [BR:ram01003]
 Polysaccharide
  Bacterial polysaccharide
   MCE_01280
Lipopolysaccharide biosynthesis proteins [BR:ram01005]
 Core region
  MCE_01280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
212432..213826
Genome map
AA seq 464 aa AA seqDB search
MMLLYYALSFILLPVYFIIILIRLLIGKEDIRRIQERFAIGKHRQDDSLDFVQMSANKEA
FKGDTSLRTTAYTLVREDEGLGSTYKLPLEASYARRLIWIHAASVGESMAALTLIHNISK
RYPDVRFLVTSWTNSSAKILTAKLPKIAVQQFLPIDNIIFTRKFLRNWQPDLGIFIESEL
WPCTINEGAKQCKLLLVNARISDKSFKAWLKRKSFFQLILKNFSKIIVQSECDLQKFNEL
GVSDAVNLGNIKFANEKLPVNQEALSKLSLHLDNRRVVLFASTHPEDEEVILPIIKNLKE
QFLDCYIILIPRHPERVKSIIDNCKSHNLSATAKSQNDLPVLSDDLYIVDRFGEMGLFFS
VATISFIGGSFKQGGHNILEAAYFSNCIIFGPDMSKNTDIAKGVLQNESAIQIKNGEDLL
TKLTYLLRSNNSLELKAYRGNALKFVKDNQKVLDEYLKVITKFL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatgttattatattatgctttaagctttatattattacctgtttattttatcataatt
cttatacgtttattaataggtaaagaagatataagacgcatccaagagcgttttgctatt
ggcaaacacagacaagacgattcattagacttcgtgcaaatgtccgctaataaagaggca
tttaaaggagacacttcactgcgaaccacagcgtacacactagtacgtgaggatgaaggg
ttaggatcgacgtataaattacctttagaagcaagttatgcacgaaggctgatatggatt
catgcagcaagcgttggcgagtctatggcagctttaacattaatacataatataagtaaa
cgctaccctgacgttcgttttctagtaacttcttggactaacagctctgctaaaatatta
actgccaaattacctaaaatagcagttcagcaatttttaccgatagataatattattttt
actcgaaaatttttaagaaattggcaacctgatttaggcatttttatagaatcggaacta
tggccgtgtactattaatgagggcgcaaagcagtgtaaattactactagttaatgctcgt
atttctgataaatcgtttaaagcttggctaaaaagaaaaagcttttttcagcttattctt
aaaaatttcagtaaaattatcgtgcaaagtgagtgtgacttacaaaaattcaatgaactt
ggcgtatcagatgcagtgaatttaggcaatattaaatttgccaacgaaaaacttccggtc
aatcaagaagcgttatcaaaattaagcttacatttagacaataggcgagtcgtgctattt
gccagcactcaccccgaagatgaagaggtgattttgcctataatcaaaaacctaaaagag
cagtttttagactgctatattatcttaattccaagacatcctgagcgagttaaatcaatt
atcgataattgtaagtcacataatttatccgctaccgctaagtcgcaaaatgatttacct
gttttaagcgatgatctttatatagttgataggttcggcgaaatgggactatttttttct
gtagctacaatttcttttatcggtggttcttttaaacaaggcgggcataatattttagaa
gcggcatatttctctaattgtattatattcggtcccgatatgagcaaaaacaccgatatc
gctaaaggcgtactgcaaaatgaatcagctatccaaatcaaaaacggtgaagatttacta
accaaactaacatatctactcaggtctaataattctctagaacttaaagcttaccgcgga
aatgctttaaaatttgttaaggacaaccaaaaagtcctagatgaatatttaaaagtaatt
acgaagtttctttga

DBGET integrated database retrieval system