KEGG   Candidatus Rickettsia amblyommii: MCE_01835Help
Entry
MCE_01835         CDS       T01787                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ram  Candidatus Rickettsia amblyommii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ram00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCE_01835
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCE_01835
  Amino acid metabolism
   00310 Lysine degradation
    MCE_01835
Enzymes [BR:ram01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MCE_01835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(319663..320862)
Genome map
AA seq 399 aa AA seqDB search
MSVKIIVPSLGESVTEATIAKWHKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS
KTDSANVAVGEEIGEINEGATANTTDTNNASAKAQAVTQPTSEKPVEKPAVANNTLAPSV
QKLVTENKLDPNNIKGTGRDGRITKGDVLETINTTATSAPAISKSNEERVQRVRMSRLRK
TIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIEAL
KLIPSVNAEIDGDNLVYKNYYDIGVAVGTEQGLVVPVVRNADKMGFAEVEKAIEILAKKA
REGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIRS
MMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttaaaattatagtaccgtcgcttggggagtccgtaacggaagcaactattgcc
aaatggcataagaaagaaggcgattcggttaaaaccgatgaattactgttagaaatcgaa
accgaaaaagtgactttagaagttaatgctccttgcaacggtactataggtaaaatatcg
aaaactgacagtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggggca
actgcaaatactaccgatactaataatgcatctgctaaagctcaagcagtgacgcaacct
acttcagaaaagcctgtagaaaaacctgccgtggctaataatactcttgctccttctgta
caaaaattagttaccgaaaataagcttgaccccaataatataaaaggaacaggtagagac
ggtagaattaccaaaggtgacgtgcttgaaacaataaacactacggctacttctgctcct
gcaataagtaaatctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttgcgtaaa
actattgcacaacgtttaaaagattcacaaaatacagcagctattttgactacttttaat
gaaatcgatatgtcaaaagtaattgctttgcgtaatcaatataaagaagagtttgagaaa
aagcacgctgtgaaacttgggtttatgtctttctttgttaaagcaacaattgaagcttta
aagcttattccgtcggtaaatgctgaaatagacggtgataatttagtatataaaaattac
tatgatataggtgtagctgttggaacagagcaagggcttgttgtaccggttgttaggaat
gccgataaaatgggatttgccgaagtggagaaagctatagaaattttggctaaaaaagct
cgtgagggtaagctttctatggctgatttgtcaggtgggacattctcgatttctaacgga
ggcgtatatggctcattattatctacaccaattattaatcctcctcaatcaggtattcta
ggcttacataaaaccgaggaaagagctgtagttatagacggtaaaattgaaatacgttcg
atgatgtatatagctttatcttacgatcatcgtataattgacgggaaagaaggagtatcg
ttcttggtaaaaattaagcagcttattgagaatcctgaaaagttattgttaaatttgtaa

DBGET integrated database retrieval system