KEGG   Rickettsia amblyommatis GAT-30V: MCE_02390Help
Entry
MCE_02390         CDS       T01787                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
ram  Rickettsia amblyommatis GAT-30V
Pathway
ram02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ram00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MCE_02390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 SDF
Motif
Other DBs
NCBI-ProteinID: AFC69458
UniProt: H8K4L4
Position
complement(424085..424612)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVAVQESSENQNTTALEQ
APINIPELMKTANADHGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
DLSKLGGVWDDDSLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatacaagcccactctagagttacaacaccgc
ggctacagcgttgcggttcaagaatcatcagaaaatcaaaatactaccgcactagagcaa
gcaccgataaatataccagaattaatgaagactgctaacgccgatcacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcaagcatagcagactataaatattcccct
gatctatcaaaacttggcggcgtatgggatgatgatagtttatttgctttcttacataaa
ccaagtagctatgcaccaggaactaaaatgtcctttgccggtatctcaaaaccacaagac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system