KEGG   Rickettsia amblyommatis GAT-30V: MCE_03880Help
Entry
MCE_03880         CDS       T01787                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ram  Rickettsia amblyommatis GAT-30V
Pathway
ram00020  Citrate cycle (TCA cycle)
ram00640  Propanoate metabolism
ram01100  Metabolic pathways
ram01110  Biosynthesis of secondary metabolites
ram01120  Microbial metabolism in diverse environments
ram01130  Biosynthesis of antibiotics
ram01200  Carbon metabolism
Module
ram_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ram_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ram00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCE_03880 (sucC)
   00640 Propanoate metabolism
    MCE_03880 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MCE_03880 (sucC)
Enzymes [BR:ram01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MCE_03880 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFC69699
UniProt: H8K5A5
Position
complement(678802..679962)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGLVVTKTAKINETIDKLNTEVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDIVKEYYFSIVFDRSASC
ITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEI
VKSIYNAFIETDAAQIEINPLIVNSDGNLLALDAKITFDDNGLFQHPNITAMRDHDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGASPANFLDVGGGADRERVKE
ALKIILSDKEVQGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGEEI
LSNSGLEIIPAHDLADAANKIVEAIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacggcgtacctacttcc
accgggctagttgttacgaaaaccgcaaagattaatgaaaccatagataaattaaatacg
gaagtatatgtagttaaagcacaaatacatgccggcggtagaggtaaagcaggcggtgtt
aaggttgttaagagtaaagaagaagccaaaaaagttgctcatgacatgtttggtattaat
ttagtaacgcatcaaacaggacctcaaggacaaaaagtaaaccgtctttatatcgaatca
ggttgtgatattgtaaaagaatattattttagtatagtatttgatagatcggctagctgt
attactttcatagcttctacagaaggaggagttgatattgaagaagtagcagaaaaaact
ccggaaaaaattattaaattttccgttgatcctgcaactggtttacaagattttcatatg
cgaggcatagcttatgagttaggctttaaggataaccaagccaaacagatgaaagaaata
gtaaaatcaatctataatgcttttattgaaaccgatgcagcacaaattgaaatcaaccca
ttaattgtaaatagcgacgggaacttattagctttagatgcaaaaattacttttgacgac
aacggcttatttcagcatccgaatattacggcaatgcgtgatcatgatgaagaagatcct
ctagaaactagagcagcaaatgcaggacttagctatgtaaaaatggacggtaatatcggt
tgcatggttaacggtgccggtcttgccatggccactatggatattattaaactttacggt
gcttcgcctgctaatttcttggatgtcggtggtggagctgatcgtgagcgtgtaaaagaa
gctttaaaaataattttatctgataaagaagtacaagggattctagttaatattttcggc
ggtatcatgcgttgtgatattatagcagaagggattattgcagctgcaaaagacataggt
ataaaagtaccattagtagttcgtttagccggtacaaacgttgaaaaaggcgaagaaatt
ttatcaaattccggtttagaaataataccggcacatgatttagcagatgcggcaaataaa
atagttgaagcgatacggtag

DBGET integrated database retrieval system