KEGG   Candidatus Rickettsia amblyommii: MCE_04445Help
Entry
MCE_04445         CDS       T01787                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ram  Candidatus Rickettsia amblyommii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ram00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCE_04445
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCE_04445
   00020 Citrate cycle (TCA cycle)
    MCE_04445
   00620 Pyruvate metabolism
    MCE_04445
Enzymes [BR:ram01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MCE_04445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
771595..772833
Genome map
AA seq 412 aa AA seqDB search
MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV
IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLPKPHENIANVEEQ
VTVIKHDASKILASPLAKRLAKMGNIRVESVKGSGPHGRIVKQDILSYTPSTAHNKIVSR
NPEEDRLVPNNNIRKTIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSFSEDKSTR
ISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVTPIVKNANQKN
ILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGVGAS
AKRAIVKNDQITIATIMDITLSADHRVVDGAVGAEFLAAFKKFIESPALMLI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttatctccaactatgacggaaggaaatctagct
aggtggttaaaaaaagaaggggacaaagttaatcctggggaagtaattgctgaaattgaa
accgataaagcaacgatggaagtagaagcagtagacgaaggtatacttgctaaaatagtt
atcccgcaaaatagtcaaaatgtacctgttaactctttaattgctgtgttaagtgaagag
ggagaagaaaaaacggacattgatgcgtttattgcaaaaaataatagtgtatcaccgtcg
ccgaaaacagatgctaatcttccgaaaccccacgagaatatagctaatgtagaagaacag
gtaacagttataaaacatgatgctagtaaaatactcgcctcaccgcttgcaaaaagactt
gcaaaaatgggaaatattagagttgagagcgtgaaaggtagcggcccgcacggtagaata
gtcaaacaagatatcttatcatatactcctagcactgctcataataaaatagttagcaga
aatcctgaagaagatcgtttagtaccaaataataatatccgcaagactatagccaagcgt
ctgcttgaatctaaacaaacagttccacatttttatttatctatagaatgtaatgtcgat
aaattgttagatataagagaagacattaataaatctttttctgaagataaatcaacaagg
atatcggttaatgattttattattttagcagtagccaaagctttacaagaagtgccaaat
gccaatgctagctggggagaagatgcaattagatattacaataatgtcgatatttcagta
gcggtagcgattgagaacgggcttgttacgccgatagttaaaaatgccaatcaaaaaaac
attctagaactatctcgtgaaatgaaagcattaataaagaaagcaaaagataataaatta
acccctgaagaatttcagggcggagggtttaccatttctaacctcggtatgtatggtatt
aagaatttcaatgctataattaacccaccgcaaagttgtataatgggcgtcggagctagt
gcaaaacgtgctatagtcaagaatgatcaaataactatagcaacaattatggacataact
ctttcggccgatcaccgagtagtagacggagcagtcggtgctgagttcttggcagcattt
aaaaagtttatagagagtcccgctttgatgttgatataa

DBGET integrated database retrieval system