KEGG   Rickettsia amblyommatis GAT-30V: MCE_04950Help
Entry
MCE_04950         CDS       T01787                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ram  Rickettsia amblyommatis GAT-30V
Pathway
ram00071  Fatty acid degradation
ram00280  Valine, leucine and isoleucine degradation
ram00281  Geraniol degradation
ram00310  Lysine degradation
ram00362  Benzoate degradation
ram00380  Tryptophan metabolism
ram00640  Propanoate metabolism
ram00650  Butanoate metabolism
ram00903  Limonene and pinene degradation
ram00930  Caprolactam degradation
ram01040  Biosynthesis of unsaturated fatty acids
ram01100  Metabolic pathways
ram01110  Biosynthesis of secondary metabolites
ram01120  Microbial metabolism in diverse environments
ram01130  Biosynthesis of antibiotics
ram01200  Carbon metabolism
ram01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ram00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MCE_04950
   00650 Butanoate metabolism
    MCE_04950
  Lipid metabolism
   00071 Fatty acid degradation
    MCE_04950
   01040 Biosynthesis of unsaturated fatty acids
    MCE_04950
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCE_04950
   00310 Lysine degradation
    MCE_04950
   00380 Tryptophan metabolism
    MCE_04950
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MCE_04950
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MCE_04950
   00281 Geraniol degradation
    MCE_04950
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCE_04950
   00930 Caprolactam degradation
    MCE_04950
Enzymes [BR:ram01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MCE_04950
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MCE_04950
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MCE_04950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_2 ECH_1 NAD_binding_2 UDPG_MGDP_dh_N NAD_Gly3P_dh_N F420_oxidored Sacchrp_dh_NADP ApbA Shikimate_DH 2-Hacid_dh_C DAO NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AFC69865
UniProt: H8K5S1
Position
857363..859525
Genome map
AA seq 720 aa AA seqDB search
MQNEIKKVCVIGAGVMGSGIAALIANSSHKVVLLDIIAKDSDDPNKIVKTAKENLYKQQP
PPLSFPDKANFITIGNLEYDLDLIKECDLVIEVIVEKLEIKHQLYNKIIPYLKEDAIIAS
NTSTLPLKRLKENLPDNIKSRFVITHFFNPPRYMELLELIIDPTIKAAVIEKVSEFLTKT
LGKIIVKCNDTPGFIANRVGCFLLELVARKAISQNLDVATIDKIFTTCLGLPSTGIFGLY
DLIGHDVMKLISSSLLASLPANDAYHKIYVKTPVLDKMIEKQLIGRKGDGGFYRLSVSNG
KKIKEVININNLSYSPVQKVDISFNNLDELLVSDSVYGKFFTEIITEFYVYLASLVPSVM
DNIYDIDAAMKLGYSWKYGPFELLTIAAKNGWNAVIKNVDLMHIPLPQYLANKEYQKIDK
QKFNSHKDILQESQIVLENSSAKLILYQDALIFVITTKMNCLNHAVFYLLQEAASKAEND
GKNLYIYPQGNNFSAGADLKLLLSYMEDKNFHDLENLLKLGQQTMLHLKYSSVHVISCGL
GVALGGGCELLLHSSFIIGNQELNAGLVELGVGLIPGWGGVTEMFARSNGNKTKLIRNIS
NIIEQNKTSSADYFKADYDVENIHINMNKHYILEEALKLNLPKKIVPIPHKIILPKINLA
TAIDTSKYNDLQNKVLSKFQDIIDTHNETNEEELLTYEQEIFLELAKDPRTIEKLKVIVG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgaaataaaaaaagtttgtgttatcggtgcgggagtaatgggttcagggatt
gcagcgttaattgctaattcctctcataaagtagtgctgcttgatattatcgctaaagat
tccgatgatcctaataaaatagttaaaaccgctaaagaaaatttgtataaacaacaacct
ccacctttatcttttcctgataaagcaaatttcattaccatcggtaatttagaatatgat
ttagatttaattaaagaatgtgatttagttattgaagttattgttgagaagttagaaatc
aaacaccaattatataataaaattattccttatcttaaagaagatgcaattattgcttct
aatacctctacattaccgcttaaaagactcaaagagaatttaccagataatattaaatct
agattcgttattacgcatttcttcaatccgccaagatatatggaactgcttgagttaatt
atagaccctacgataaaggctgcagtaatagaaaaagtatcagagttcttaacgaaaacg
cttggtaaaattatagtaaaatgtaatgatacgcctggttttattgctaatagagtaggg
tgttttttacttgaattagtagcccgtaaagcgataagtcagaatcttgatgttgctact
atagataaaatatttactacatgtttggggctgccgagtaccggaattttcggtttatat
gatctaatcgggcatgacgtaatgaagttaatttcaagttcattacttgcctctcttcct
gcaaatgatgcttatcataaaatatatgtaaagacccctgttcttgataagatgatagag
aagcagttaattggacgtaaaggtgacggtggattttatcgtttatcggtatcaaatggg
aaaaagattaaagaagttatcaatataaacaacttatcatatagtcctgttcaaaaagta
gatatttcatttaataatcttgatgagcttcttgtaagtgattcggtttacggtaaattt
tttactgaaattatcacggaattttatgtttatttagcaagtctagttccgtcggttatg
gataatatttatgatatcgatgctgctatgaagcttggttacagctggaaatacggtcca
tttgaattattgactatagcggctaaaaacggctggaatgcggtaattaaaaatgtcgat
ttaatgcatatcccacttccgcaatatttagccaataaagaatatcaaaaaatcgataaa
caaaaatttaattctcacaaagatattttacaagaaagtcagatagtattagagaatagc
tcggcaaaattaatactttatcaagatgctttgatttttgttattacgacaaaaatgaat
tgtttaaatcatgcggtgttttatttactacaagaagcagcaagtaaagccgaaaatgac
ggtaaaaatctttatatttatccgcaaggaaataatttttctgccggtgctgatttaaaa
cttcttctttcttatatggaagataagaattttcatgatctagagaatttactaaaactg
ggacagcaaaccatgctccacttaaaatattcctctgtacatgttattagctgtggtctt
ggtgtggcacttggaggtggatgtgagctgttattgcactcaagctttattataggaaat
caagaacttaacgcagggcttgtagaacttggtgttggtttaatacccggatggggcggt
gttaccgaaatgtttgctcgaagtaatggtaataaaactaaactaattagaaatatcagc
aatattatagagcagaataaaacaagttcagccgattactttaaagcagattatgatgta
gagaatatacacataaatatgaacaagcattatattttagaggaagctttaaaattaaac
ctacctaaaaagatagtaccgattccgcataaaattattttgcctaaaataaatttagca
acagcaatagatacatcaaaatataacgatctacaaaataaggtacttagcaaatttcaa
gatattattgatacacataatgaaacgaatgaagaagagctacttacctatgagcaggaa
atatttttagaacttgcaaaagatccaagaactatagagaagctgaaagtaattgtagga
taa

DBGET integrated database retrieval system