KEGG   Candidatus Rickettsia amblyommii: MCE_05180Help
Entry
MCE_05180         CDS       T01787                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ram  Candidatus Rickettsia amblyommii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ram00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MCE_05180
Enzymes [BR:ram01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MCE_05180
Exosome [BR:ram04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCE_05180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899125..900117
Genome map
AA seq 330 aa AA seqDB search
MYPHIRLRRNRKAFWLRELISESNLSVSDLVLPLFVVEGHNERQEIKTMPGIYRLSIDQI
VETAKEAAELGINVITLFPSIDQSLKSDNADEAYNLDNLICRTIRSIKNANIDIGIICDV
ALDPYTTHGHDGIVHHGAVDNDRSVRALCNQALVLAKAGVDIVAPSDMMDGRIGAIREYL
DKEGFINVGILAYAVKYASSLYGPFRDAVKSNKKNYLDKSSYQMDVRNIKEAMLEIEHDI
AEGADMVMVKPGMPFLDVIREAANNFNAKIFAYQVSGEYAMLKFAAEAGAIDWERALMES
LISFKRAGATGIFTYAALEVAEILKNNKIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtacccccatattagacttagaagaaatagaaaagctttttggcttagagagttaata
tccgaaagtaatttatcggttagtgatttagtattgcctttatttgttgttgaaggacat
aatgaaaggcaagaaattaaaactatgcctggtatatatcgtttatcgattgatcaaata
gtagaaacggcaaaagaagcagcagagcttggtattaatgttattacattatttccgagt
attgatcaaagtctaaaaagtgacaatgctgatgaggcttataatttagataatttaata
tgtagaactattagaagcatcaaaaacgctaatatcgatattggtataatatgcgatgta
gcacttgatccttatactacacatggtcatgacggtattgtgcatcatggggcagttgat
aatgatagatcagtaagagctttgtgtaatcaagcattagtgctagcaaaagctggagta
gatattgttgcaccttccgatatgatggatggaagaatcggggctataagggaatatctt
gacaaagagggatttataaatgttggaattcttgcttatgccgttaaatatgcttcaagt
ctttacggtccgtttcgcgatgctgttaagagtaataaaaagaattatttagataaatca
agctatcaaatggatgtacgtaatattaaggaagcaatgcttgagattgagcatgatata
gcagagggagccgatatggtaatggtgaagcctggtatgccgtttttggatgttattcgt
gaagcggcaaataattttaatgctaaaatttttgcatatcaggttagtggagaatatgca
atgttaaaatttgcagcagaagcaggggcaattgattgggagagagctttgatggagtca
ttaattagttttaaacgtgccggtgctacaggtatatttacctatgcagctcttgaagta
gctgaaatattaaagaacaataaaattaagtag

DBGET integrated database retrieval system