KEGG   Candidatus Rickettsia amblyommii: MCE_08125Help
Entry
MCE_08125         CDS       T01787                                 

Definition
helicase RecD/TraA
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ram  Candidatus Rickettsia amblyommii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ram00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCE_08125
Enzymes [BR:ram01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MCE_08125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMCE_1:join(30619..31974,1..813)
Genome map
AA seq 722 aa AA seqDB search
MNKKDANEYISGIIERITYHNPDNGFCVLRIKVKGHRDLITVTGNVPSALVGEYIKCSGI
WHNDRNHGRQFKAHFLKALPPDTLEGIEKYLGSGLIKGIGPYFAKKLVLAFKDRVLEVIE
HEPHLLSTVDGIGNARANRICNNWQAQKVIREIMVFLQSHGVGTTRATRIYKTYGDKAIE
IVSNNPYQLAKDIRGFGFISADTIARNLGIDKNSLIRAKAGVIHSLLEATSDGHCGLPKK
ILLQNIQKLLEIEYDIIEQAIIEEVALNSLIIDTINYVEFIFLTSYYIYEKNIAKILVNL
TKASVTWGKIDTITILPTIEKELGITLATSQKTAIEHALQHKLMVITGGPGTGKTTLVNS
LLKTLTTKKLNIKLCAPTGRAAKRLSESTGLETTTIHRLLEIDPAYGGFKRNEDSPLLCD
YLVIDEASMVDISLFHALLKALPPHSALLIVGDVDQLPSVGAGQVLKDIINSKVIPTVKL
TEIFRQAATSNIIINAHRVNNGILPDLAQTNKASDFYFIEAEHGKDIINKIIMMIRERIP
KKFNLNPVNDIQLLCPMQRGGVGARSLNIELQKILNPNYRSGITKFGQIFAIGDKVMQTE
NNYDKEVYNGDIGVINNINEQDQEITINFYNRDVVYDYSDLDQMTLAYATTIHKSQGSEY
PAVIIPLTTQSYMMLKRNLIYTAITRGKHLVIIIGQKKALAIAIKDNKTFLRYSKLEEWL
IG
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaggatgctaatgaatacatatccggcatcatagagcgaattacttatcat
aaccctgataatggattttgtgtattacgtattaaggtaaaaggtcatagggatttaatc
acagttacaggtaacgtaccatctgcactcgtaggggaatatataaaatgcagtggtatt
tggcataatgatagaaaccatggcagacaatttaaggctcatttcctaaaggctttacca
cctgatacattagagggtatagaaaaatatctcggctctggattgattaaaggcatagga
ccatattttgctaagaaattagtattagcatttaaagatagagtgcttgaagttattgaa
catgagcctcaccttttatctactgtagatgggataggcaatgcaagagctaatcgcatt
tgcaacaactggcaagcacaaaaagtcattcgtgaaataatggtctttctacaatctcat
ggagttggtactactagagcgactagaatctataaaacatatggtgataaagcaattgaa
attgtatccaataacccttatcaattagctaaagatataagagggtttggatttatctca
gcagataccatagctcgtaatttaggtatcgataagaattctttaatcagagccaaagca
ggtgtaatccactcattacttgaagcgacgtcagatggtcattgtggcttacctaaaaag
atattactgcaaaatattcaaaaattacttgagatagaatacgatatcattgagcaggct
ataatagaagaagtagcattaaattcactgataattgatactattaattatgtagaattc
attttcttaactagttattacatatatgagaaaaatattgctaaaatactagtcaattta
acaaaagcttctgttacttggggcaaaatagataccattactattctacccacaatagag
aaagagctaggtatcacgcttgcaacaagtcaaaaaacagctatagagcatgcactgcaa
cataagttaatggttattacgggtggaccaggaacaggaaaaaccacattagtaaattca
ttactgaagacacttacaacaaaaaaattaaatattaaattatgtgctccaactggtaga
gcagctaagcgcctaagcgaaagtacaggattagaaacgactactatacatagattgctt
gaaattgatcctgcttatggtggttttaaacgtaatgaggattcaccattactgtgcgat
tatctagtaatagatgaagcttcaatggttgatatatcactatttcatgcattattaaaa
gccctgccgccacactcagcattactaatagtcggtgatgtagatcaactgccttctgta
ggtgctggacaagtactcaaggatattattaattctaaggttataccgacggtcaagtta
actgaaatatttaggcaagcagcaacaagcaatattattattaatgctcatcgtgtgaat
aatggtatcttgcctgatcttgcacagacaaacaaagcatcagatttttattttatagaa
gcagagcatggtaaagatatcattaataaaataattatgatgataagggaacgtatccct
aaaaagtttaatcttaatcctgtaaatgatatccaattactatgtcctatgcaaagaggt
ggtgttggtgctagatcattaaatattgaattacaaaaaatacttaatcccaactataga
agcggcataactaaatttggtcagatttttgctattggcgataaagttatgcaaacagaa
aataattatgataaggaagtctataatggagatataggagttattaataatattaatgag
caggatcaagaaatcacaataaacttttataaccgtgatgtggtttatgattatagtgat
cttgatcaaatgaccctggcatatgctactacgatacataaatctcaaggttcagaatat
ccagcagtaataattccattaactacgcaaagttatatgatgcttaaacgtaatttaatt
tacactgccatcacccgcggcaagcatctagttataataattggacagaaaaaagcatta
gctatagctattaaagataataaaacttttttgcgttattcaaaattggaagaatggtta
attggttag

DBGET integrated database retrieval system