KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0202Help
Entry
Riean_0202        CDS       T01363                                 

Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ran03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
219915..220523
Genome map
AA seq 202 aa AA seqDB search
MNFPSKVLEKAVEEISGLPGIGRKSALRLALHLLRQPSSQGLALGDAIQNLVTEIKYCKE
CHNFSDTDICEICADDSRHAELLCVVEDVRDVMAIENTGKFKGKYLVLGGKISPMEGIGP
QQLNIETLESKLEIGEIEEVIFALSATMEGDTTVYYLYKKFKHFDIKFSNIARGISVGDE
LEYADEVSLGRSILNRIPYKGH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaattttccaagtaaggttttagaaaaagcagtagaagaaatatcaggtctcccaggg
ataggcagaaagtcggctctcagactagcgcttcatttgcttagacaaccgagttcacaa
ggattagctctaggcgatgctatacaaaatctagttacagagataaaatattgtaaagaa
tgccataacttttcggacacagatatttgcgaaatttgtgcagatgacagtagacacgct
gaactcctatgcgttgtggaagatgtgagagatgtaatggcgatagaaaacacaggaaaa
ttcaaaggaaaatatttggttttaggaggaaaaatatcgcctatggaaggtattggacct
caacaattaaatatagaaactttagaaagcaaactagaaataggggagatagaggaggtt
atttttgcactatctgccactatggagggcgataccaccgtgtattatttgtataaaaag
tttaagcattttgacattaaattctccaatattgcgagagggatttccgtaggagatgaa
ctagagtacgccgatgaagtttctttggggaggtctattttgaaccgaataccttataaa
ggtcattaa

DBGET integrated database retrieval system