KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0202Help
Entry
Riean_0202        CDS       T01363                                 

Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ran00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Riean_0202
DNA repair and recombination proteins [BR:ran03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Riean_0202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
219915..220523
Genome map
AA seq 202 aa AA seqDB search
MNFPSKVLEKAVEEISGLPGIGRKSALRLALHLLRQPSSQGLALGDAIQNLVTEIKYCKE
CHNFSDTDICEICADDSRHAELLCVVEDVRDVMAIENTGKFKGKYLVLGGKISPMEGIGP
QQLNIETLESKLEIGEIEEVIFALSATMEGDTTVYYLYKKFKHFDIKFSNIARGISVGDE
LEYADEVSLGRSILNRIPYKGH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaattttccaagtaaggttttagaaaaagcagtagaagaaatatcaggtctcccaggg
ataggcagaaagtcggctctcagactagcgcttcatttgcttagacaaccgagttcacaa
ggattagctctaggcgatgctatacaaaatctagttacagagataaaatattgtaaagaa
tgccataacttttcggacacagatatttgcgaaatttgtgcagatgacagtagacacgct
gaactcctatgcgttgtggaagatgtgagagatgtaatggcgatagaaaacacaggaaaa
ttcaaaggaaaatatttggttttaggaggaaaaatatcgcctatggaaggtattggacct
caacaattaaatatagaaactttagaaagcaaactagaaataggggagatagaggaggtt
atttttgcactatctgccactatggagggcgataccaccgtgtattatttgtataaaaag
tttaagcattttgacattaaattctccaatattgcgagagggatttccgtaggagatgaa
ctagagtacgccgatgaagtttctttggggaggtctattttgaaccgaataccttataaa
ggtcattaa

DBGET integrated database retrieval system