KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0232Help
Entry
Riean_0232        CDS       T01363                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
ran00260  Glycine, serine and threonine metabolism
ran00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ran01100  Metabolic pathways
ran01110  Biosynthesis of secondary metabolites
ran01130  Biosynthesis of antibiotics
ran01230  Biosynthesis of amino acids
Module
ran_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Riean_0232
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Riean_0232
Enzymes [BR:ran01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Riean_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ADQ81405
JGI: Riean_0232
UniProt: E4T8Z1
Position
complement(256640..257374)
Genome map
AA seq 244 aa AA seqDB search
MKKLNIYFTAGIPQLEDTAEIIKIIQEAGADMMEIGMPYSDPVADGEVIQQAHIKALENG
MSIEKLFEQLAKIKGEICIPIILMGYINPVLSYGFEKFCQKCQETGVNGLIIPDLPPIEF
EKKYQSILKKFNLNFTFLVTPETSDERILYLDSLSSGFLYAVSSSSTTGNQSKTLKNEDY
LNRLASLPLKNPLMIGFGIKNKNDFTTVTEQADGGIIGTVFVKILLEESNWKEKAKHFIQ
SIKS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaaatatatactttacagcaggtattcctcagctggaagatactgcggaa
atcattaaaataattcaagaagctggggctgatatgatggagattggtatgccttatagc
gatcctgttgccgatggtgaggtgatacaacaagctcacattaaagccttagaaaacgga
atgtcaatagagaaactctttgaacaattggcaaaaattaagggcgaaatttgcattcca
atcattttgatgggctacatcaatcctgtgctttcttatggctttgaaaagttttgtcag
aaatgccaagaaacaggcgttaatggattgattatccctgacctccctcctattgagttt
gaaaaaaaataccaatccattctcaaaaagtttaatctaaactttacctttttagtaaca
ccagaaacatctgatgaacgaattttgtatttggatagcttaagttctggatttttgtat
gccgtgagttcctcgtccacaacgggcaaccagtccaaaacattgaaaaacgaagattac
cttaaccgattagcctcattaccactgaaaaatccactaatgataggctttgggattaaa
aataaaaacgactttaccacagttaccgaacaagccgatggcggtattatagggactgta
tttgtgaaaattcttttagaagaatcgaattggaaagaaaaagctaaacattttatacaa
agtattaaatcttag

DBGET integrated database retrieval system