KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0335Help
Entry
Riean_0335        CDS       T01363                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Riean_0335
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Riean_0335
  Amino acid metabolism
   00310 Lysine degradation
    Riean_0335
Enzymes [BR:ran01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Riean_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(359049..360362)
Genome map
AA seq 437 aa AA seqDB search
MAEYKLLLPSMGEGVMEATIISWLFDEGDFVNEDDSVVEIATDKVDSDVPTPVSGKIVKI
LKQKDEVAQVGEAIAILETEGGAVSDTIQEVPKVVETAEEVPSADVIKTIEAPLNELKVE
FSGDLYLSPLVKSIAQEENISEAELKTIQGTGLEGRITKEDILKYVENRGQSSSSVMKQE
VPQVVASSSASAVSSVPVSTSEGDEVIQMDRVRKIIADSMVRSKHTAPHVSSFIESDVTN
VVKWRNKYKNVFQQREGEKLTFMPIFVRAVVKAIQDYPMINVSVDGDKIIKKKNINIGMA
TALPDGNLIVPVIKNADQLSLSGLAKAINDLAHRARNKKLKPEDTQGATYTISNIGSFGN
LMGTPIIPLPQVAILAVGAIVKKPAVLETPEGDVIAIRQKMFMSHSYDHRVVDGSLGGMF
LKAVHDYLENWDLDTEI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatataaattattacttccttcaatgggagaaggcgttatggaagcaactatt
atttcttggctatttgatgagggtgacttcgtaaacgaggatgatagtgtagtggaaata
gcaacagacaaagtagactcagatgttcctactcctgtttcggggaagattgttaaaatt
ttaaaacaaaaagacgaagtagcacaagtaggagaggctattgcgatattagaaacagag
ggcggtgccgtatcagatactattcaagaagtaccaaaagtagttgaaactgcagaggaa
gttcctagtgctgatgttataaaaacaatagaagcacctctaaatgagttgaaagtagag
ttttcaggagatttatatttgtcgcctttagtgaaatctattgctcaggaagaaaatatt
tcggaagctgaattaaaaactatacaaggtacaggtctagaaggtagaattactaaagaa
gatatattaaaatatgtggagaatagaggtcaatcttcgtcatctgttatgaagcaggaa
gtgcctcaggtggtagcatctagtagtgcgtctgcggtatcttctgtacctgtaagcact
tctgagggagacgaagtgatacaaatggatagagttagaaaaattattgctgattctatg
gtgcgtagtaaacacacggctcctcacgtaagttcgtttattgagagtgatgttaccaat
gtggtgaaatggagaaataagtataaaaatgttttccaacagagagagggcgaaaagctt
acgtttatgcctatttttgtaagagcggtagtgaaggctattcaggattatccaatgatt
aatgtctctgtagatggagataaaattattaagaagaaaaatatcaatataggtatggca
acagctttaccagatggaaatcttattgtgcctgtaattaaaaacgcagaccaattatct
ttaagtggcttagctaaagctatcaatgatttggctcatcgtgcgagaaataaaaaacta
aaaccagaagatactcaaggagctacttatactatttctaatattggttcttttggtaat
ttaatgggtacaccaattattcctttgcctcaggtggctattttggcagtaggagctatt
gttaaaaaacctgcggtactagaaactccagagggcgatgtaattgcaattagacagaaa
atgtttatgagccattcttatgaccaccgtgtggtagatggttctctgggcggaatgttc
ttaaaagcagttcacgattatctagagaattgggatttggatacagagatttaa

DBGET integrated database retrieval system