KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0411Help
Entry
Riean_0411        CDS       T01363                                 

Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Riean_0411
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Riean_0411
  Amino acid metabolism
   00310 Lysine degradation
    Riean_0411
Enzymes [BR:ran01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Riean_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(444664..445896)
Genome map
AA seq 410 aa AA seqDB search
MSILEMKVPSPGESITEVEIATWLVQDGDYVEKDQPIAEVDSDKATLELPAEESGIITLK
AEEGDVVEVGQVVCLIDMSAAKPEGGAAKQETAKVEENKEEVKAEAPKQEASPATYATGT
PSPAAKKILDEKGVEASQVKGTGRDGRITKEDAEQASVPAMGSVFATNGSRSSKTTKLSS
LRRKLAQRLVSVKNETAMLTTFNEVDMSEIFRIRKQYKEEFAAKHGVGLGFMSFFTKAVT
RALQMYPEVNSMIDGNQMITYDFCDVSVAVSGPKGLMVPVLRNAETMSFRGVEASIKELA
EKARNGKITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSAILGMHNIIQRPVAVDGQVV
IRPMMYLALSYDHRIIDGRESVGFLVAVKEAIDNPVEHLLGGDERRGLEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatattagaaatgaaagttccctctccgggagagtctattacagaagtagaaatc
gctacttggttggttcaagatggtgattatgtagaaaaagatcagcctattgcagaagta
gattctgataaggcaacgctagaacttccagctgaagaaagtggtatcattacgctaaag
gcagaagaaggcgacgtagtagaagtaggacaagtggtttgtctaattgatatgagtgcg
gctaaaccagaaggtggtgcagctaagcaagagactgctaaagtagaagaaaataaagaa
gaagttaaagcagaagctccaaaacaagaggcttctcctgcaacctatgctacaggaaca
ccgtctcctgcagctaagaaaattctagatgaaaaaggggtagaggcatctcaagtaaaa
ggaacaggtagagatggtagaattactaaagaagatgcagaacaggcttctgtaccggct
atgggttctgtatttgctactaatgggtctagatcttctaagacaactaaattatcttca
ttgagaagaaaattagctcagcgtttagtttctgttaagaatgagacggcgatgcttact
actttcaatgaggtagatatgagtgagattttcagaattagaaaacaatataaagaggag
tttgcagcgaagcacggtgtaggtttaggctttatgtctttctttacaaaggcggttact
agagcgttacaaatgtatccagaggtaaactctatgatagacggcaatcaaatgattact
tatgatttctgcgatgtttctgtggctgtatctggtcctaaagggcttatggttcctgta
cttagaaatgcagaaacaatgtctttccgtggtgtagaggctagcattaaggaactagca
gagaaggcaagaaacgggaaaattacggtagatgaaatgacaggaggaacttttactatc
actaatggtggggtatttgggtctatgctttcaacaccgattatcaatccgcctcaatct
gcaattttaggaatgcacaacattatccaaagaccagtggcagtagatgggcaagtagtt
attcgtccaatgatgtatctagcattatcttatgaccatagaattatagacggaagagaa
tctgtaggtttcttagtagcggtaaaagaagctattgataatcctgtagaacacttgcta
ggaggtgatgaaagaagaggactagagctttaa

DBGET integrated database retrieval system