KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0447Help
Entry
Riean_0447        CDS       T01363                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Riean_0447
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Riean_0447
Enzymes [BR:ran01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Riean_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(484238..485134)
Genome map
AA seq 298 aa AA seqDB search
MLTISDLSTEKIMSLLEEAQGFTNGKIAKCQQEVYVSNLFFENSTRTKTSFDVAERKLGF
NVVPFDVSTSSVNKGETLYDTVKTLESIGVDLVVIRHSQDFYFRELETINIPIINGGDGT
GNHPSQSLLDLMTIYQEFKKFEGLKVGIVGDVKHSRVANSNAEALRRLGAKVYFSGPEDW
FDEAEFINGTYLPIDTLVKEVDVVMLLRIQHERHGEKMKLSLDKYHQKYGLTKERATQMK
PTTIIMHPAPINRGVEIDTDLVESPQSRIFKQMENGVYARMAILKQALEDKGIKFKTM
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcttacaatttcagatttatctacagagaaaattatgtctcttttagaagaggctcaa
gggtttactaatggtaaaatagccaagtgccaacaagaagtttatgtgtctaatcttttc
tttgaaaatagtacgagaaccaaaacaagttttgatgtagccgaaaggaaattgggattt
aatgttgttccttttgatgtatctacaagttcggtaaacaaaggagaaaccctttacgat
acggtaaaaactttggagagtattggagttgatttagtggtcattcgtcatagtcaggac
ttttattttagggagttggaaactattaacattcctataattaacggaggagatggcaca
ggcaatcacccttcgcaatctttgttggatttgatgacgatttatcaagaatttaaaaag
tttgaaggattaaaagtggggattgtaggcgatgttaaacacagcagggtggctaattct
aacgcagaggcactcagaaggctcggagctaaagtctatttttctggaccagaagattgg
tttgatgaagccgaatttatcaacgggacttatctgcctatagatacacttgtaaaagag
gtagatgtagtgatgcttcttcgcattcagcacgaaagacatggggagaaaatgaaatta
tctttagataaataccatcaaaaatatggtcttactaaagaaagagccactcaaatgaaa
ccaactactatcattatgcatccagctcctatcaatagaggagtggagatagatacggat
ttggtggaaagtcctcaatccagaatatttaagcaaatggagaatggtgtttacgcccga
atggcaatcctaaaacaggctttagaagacaaaggtattaagtttaaaacaatgtaa

DBGET integrated database retrieval system