KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0524Help
Entry
Riean_0524        CDS       T01363                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Riean_0524
Enzymes [BR:ran01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Riean_0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
562995..563819
Genome map
AA seq 274 aa AA seqDB search
MKTHSINCRGRLVDFSTPKIMGILNLTPDSFSDGGKFNTETSALIQTEKMLKEGASFIDL
GAQSTRPNAQLVSAQEEIKRIGNLISLIKKEFPEALISLDTFYSEVMRFGYEAGIDLIND
ISGGQFDPKVWETVAQLKLPYVLMHINPEYQAMHEKIAYDDITKSINFYFSEKINQLKAL
GIHDVILDPGFGFGKTIEDQMTMIDEVEHIGFGKYPLLIGISRKSFIYKPLGKSPLEIDE
ETQQLHLKVLQQGASILRVHDVASAKRTLDQYLS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcattctatcaactgcaggggaagacttgtagatttttctactccaaaaatt
atgggaatccttaaccttaccccagattctttttctgatggcggaaaatttaatacagaa
acttccgctttaattcaaactgaaaaaatgcttaaagaaggggcttcgtttattgattta
ggggctcaatctacacgccctaatgcccaattagtttcagcacaagaagaaattaaacgt
ataggaaacctcatcagtcttataaaaaaagaattccctgaggcactcatttctttagat
accttttatagtgaggtaatgcgttttggttacgaggcaggtatagacctcatcaatgat
atttctggtggacagtttgatcccaaagtatgggagaccgtagcccagctaaaactccct
tatgtactgatgcacattaacccagaatatcaagctatgcacgagaaaatagcctacgat
gatattactaaaagtatcaatttctatttttccgaaaaaataaatcagttgaaagcacta
ggcattcacgatgtgatattagaccctggatttgggttcggtaaaaccatagaagaccaa
atgacaatgatagacgaggtagaacacatcggatttggaaaatatcccctactgattggc
atttctagaaaatcatttatctataaacctttgggcaaatcgcccttggaaatagacgaa
gaaacgcaacaactacatttaaaagtgctccaacaaggtgctagtattctgcgagtacac
gatgttgcttcggctaaaagaacgctagaccaatacttatcataa

DBGET integrated database retrieval system