KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0546Help
Entry
Riean_0546        CDS       T01363                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Riean_0546
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Riean_0546
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Riean_0546
Enzymes [BR:ran01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Riean_0546
Exosome [BR:ran04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Riean_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(581171..582583)
Genome map
AA seq 470 aa AA seqDB search
MKRRDFLKSGSIAALGSMLISPFGLKANTIKEEFGGKKAKNIIFMVSDGMSVGTLHMADI
YSRRKLGRASHWLSLYENNLVQRAMMDMASASSIVTDSAAASSSWGGGVRVNNGSLNISP
DGKENMPILQKFKKAGKKVGCVTTVPINHATPAGFCVTSKKRSAMDDIAMDYLDLGFDVM
MGGGTKYFEADKRKDAVDLDAKFRSKGYTVVKNKAEMLSAPKNKPILGTFDEEALPYTVD
HNSCDKMKANIPTLAEMTEKAISQMKDHPKGFVMQVEGGKVDWAAHGNDVAALLYDQLAF
DEAVKVAIDFAKKDGNTLVVITSDHGNANPGLIYGKTCNDNFDHIQNFKNSNEWILQGIQ
PDSTVSFVKERIAKACGDMVLSDDQAKQLLSYYSKAKQEDGLYNPRHLPFKLLSEMQKDY
TSVGWISMDHSSDYTELAMFGPGSERLKPLMRNTDIHTFLLDAAEVENKF
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagagattttttaaagagcgggtctatagcggctttaggaagtatgcttatc
agtccgtttggtttaaaagccaatacgataaaagaagaatttggagggaaaaaagccaaa
aacatcatctttatggtgagtgatggtatgagcgtgggaaccctacatatggcagatatt
tactctagaagaaaattaggtagagcttctcattggcttagtttgtacgaaaataattta
gtacaaagagcgatgatggatatggcatcggcgagttctattgttaccgattctgcggca
gcaagttcttcgtggggtgggggagtgcgtgtaaataacgggagccttaacattagccca
gatggaaaagaaaatatgccgatactccaaaagtttaaaaaggcaggtaaaaaggtaggt
tgtgtaactacggttcctatcaaccacgctacaccagcggggttttgtgtaacttctaaa
aagagaagtgcgatggatgatattgcgatggactatttagatttaggttttgatgtgatg
atgggaggaggaactaaatattttgaagcagataaaagaaaagacgccgtagacttagat
gctaagttccgctctaaaggttatacggtggtaaaaaataaagcagagatgttgtccgct
cctaaaaataaacctatcctaggtacttttgatgaggaggcattgccgtatactgtagac
cataatagttgtgataaaatgaaagccaatatccctactttggcagagatgacggagaag
gctatatcgcagatgaaagaccaccctaaaggctttgtaatgcaagtagaaggcggtaag
gtggactgggcggcacacggtaatgatgtggcggctctgctatacgaccagttggctttt
gatgaggcggtgaaggtcgctatagattttgcaaagaaagacggtaatactttggtggta
attacttctgaccacggaaatgctaacccagggcttatctatggtaaaacttgtaatgat
aattttgaccatatacaaaactttaaaaactctaacgaatggatattgcaagggatacag
cctgatagcactgtttctttcgttaaagagagaatagccaaggcgtgtggagatatggtg
ttgtctgatgaccaagcgaagcagctattatcctactactctaaagcaaagcaagaagat
ggtttgtataaccctcgccacttgccgtttaagctcctttccgagatgcaaaaagactat
acctctgtggggtggataagtatggaccactcctcggactatacagaacttgcgatgttt
ggaccaggaagcgaacgcttaaaaccgctgatgagaaatacagatatacatacattctta
ctagacgctgctgaagtagaaaataagttttag

DBGET integrated database retrieval system