KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0577Help
Entry
Riean_0577        CDS       T01363                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Riean_0577
Enzymes [BR:ran01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Riean_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(617827..618276)
Genome map
AA seq 149 aa AA seqDB search
MSQRKVILLLGSNIKNPKKNIEEAILLINKHLGNVIKKSKMLETEPVEFVSSNNFCNIAL
SLETDFSPIQILKKAKEIERYMGRVLDSRDLGGYEDRVIDVDIVAIGNLSYQSKMLNLPH
HRHLFVRNFSRKILEDLGENIEKYKNIQI
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaagaaaggttattttgttactaggaagcaatataaaaaatcctaaaaaaaat
atagaagaagctattttattgataaacaagcatctaggaaatgtgataaaaaagagtaaa
atgctagaaacagagcctgtggagtttgttagttctaataatttttgtaatattgcactc
tcgttggagactgatttttcgcctattcaaattttgaagaaagcaaaagaaatagaaagg
tatatgggaagggttcttgattctagggatttgggaggttatgaagatagagttatagat
gttgatatagttgccataggcaatctttcgtatcagtcaaaaatgttaaatttaccccat
cataggcatctttttgtgcgtaatttttctaggaaaattctagaagatttgggagagaat
attgaaaaatataaaaacattcaaatatga

DBGET integrated database retrieval system