KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0631Help
Entry
Riean_0631        CDS       T01363                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
ran00860  Porphyrin and chlorophyll metabolism
ran01100  Metabolic pathways
ran01110  Biosynthesis of secondary metabolites
ran01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Riean_0631
Enzymes [BR:ran01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Riean_0631
Exosome [BR:ran04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Riean_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADQ81795
JGI: Riean_0631
UniProt: E4T9W4
Position
complement(684380..685372)
Genome map
AA seq 330 aa AA seqDB search
MIIYSRNRRLRRNDSLRSLVRENHLSTSDFVMPMFVMEGEKKQEAIPSMPGIYRRSIDLT
VEECKELFALGVKAVNIYMKVSDHLKDNAGTEAWNPNGLMQNTIRAIKEAVPEMVVMPDV
ALDPYSIYGHDGIVTNGEVDNDATVEALVKMSISQAEAGADIVAPSDMMDGRVMAIREGL
EENGFHNVGILSYAAKYASSFYGPFRSALDSAPKETANIPKDKKTYQMDFHNTREAINEV
IRDVEEGADIIMIKPGMPYLDIVSKVRELIDIPIAVYQVSGEYAMLKAASQNGWLDNDKV
LIESLTCFKRAGADMIFTYAAKEAAMLLQK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgattatatattcaagaaatagaagattaagacgaaatgacagccttagaagtcttgta
agagagaaccatctttcaacatctgattttgtaatgcctatgtttgtgatggaaggagaa
aagaaacaagaggctatcccttctatgcctggtatctatcgcagaagtatagatttaacg
gtagaagaatgtaaagagctattcgctttgggtgtgaaagcagttaatatctatatgaag
gtttcagaccatctcaaagataatgcaggaacagaagcatggaatcctaatgggttgatg
caaaacaccataagagctattaaagaagctgttccagaaatggtagtgatgcctgatgta
gctttagacccttattctatctacggacacgatggtattgtaactaatggtgaagtggat
aatgatgctacagtggaagctttggttaagatgtctatttctcaagctgaagctggagcg
gatattgtagcaccaagtgatatgatggacggcagagtaatggctataagagaaggatta
gaggaaaatgggtttcataatgtaggtattttgtcttatgcggcgaaatatgcaagttct
ttctatggacctttcagaagtgcgttggatagtgctccgaaggaaaccgcaaacattccg
aaggataaaaaaacttatcaaatggattttcataatactagagaagctataaatgaagtg
attagagatgtagaggaaggagctgatattattatgataaagccaggtatgccttattta
gacattgtttctaaagttagagagctaatagatattcctattgcggtgtatcaagtaagt
ggagaatatgccatgctaaaagctgcttcgcagaatggttggctagacaatgataaagtc
ttaatagaaagtcttacttgctttaagagagctggggctgatatgattttcacctatgca
gcaaaagaagccgcaatgcttctacaaaaataa

DBGET integrated database retrieval system