KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0677Help
Entry
Riean_0677        CDS       T01363                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
ran00480  Glutathione metabolism
ran00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Riean_0677
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Riean_0677
Enzymes [BR:ran01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Riean_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin RuvX
Motif
Other DBs
NCBI-ProteinID: ADQ81841
JGI: Riean_0677
UniProt: E4TBL2
Position
complement(730311..730877)
Genome map
AA seq 188 aa AA seqDB search
MKKLFIFILSALALVQCSSKKREVQQDTSKLSKSIYDYKVESLDGGEINFADFKGKKILI
VNTASECGFTPQYEALEKLYQKYKDRLVVVGFPANNFGGQEPGTNTEIKTFCQVNYGVTF
PMAAKVSVKGEDIAPIFQFLTKKELNGVKDTTILWNFTKFLLDENGKIIESYLSTTKPDS
EAITKHLK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactctttatattcatactttccgcactcgctttagtgcaatgttctagtaaa
aaaagagaggttcaacaggatacatctaagctttctaaaagtatctacgattataaagtg
gaaagtttagacggtggagaaattaattttgcggatttcaaaggcaaaaaaatacttatt
gtaaatacagcgtctgagtgtggttttacacctcagtatgaagccttggaaaagctctat
caaaaatataaagataggctagtggtagtaggcttccctgctaataactttggaggacaa
gagccaggaactaataccgagattaaaactttttgtcaagtgaactatggagtaactttt
cctatggcagctaaggtttctgtgaaaggagaagatatagcacctatttttcagtttctt
actaaaaaggaattaaacggagttaaagataccaccatactttggaattttaccaaattt
cttctagacgaaaacggaaaaataatagaaagctatctaagtactactaagcctgatagc
gaagcgattacaaaacatttaaaataa

DBGET integrated database retrieval system