KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0689Help
Entry
Riean_0689        CDS       T01363                                 

Definition
pfkb domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Riean_0689
Enzymes [BR:ran01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Riean_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
742821..743714
Genome map
AA seq 297 aa AA seqDB search
MKLSKEQPRILVVGSSSVDLVLKTEHYPELGETVMANSSENFFGGKGANQAVGTARLGAS
VYFVGCVGMDPYGQQILRNLVEENVNVGFVVENPDIETGTAYVTTSKGKNAIVVVPSANY
ALSPKHLENPKHLFETADLVLVQLEITDTVIEKVLELCKKNGTKLGIYAAPARPLSKELI
EYASFIVAKSNDLSTLFGDDHRDAVLQKLPNKLFVRDDTNSTIYYNGSEMKYFRNDPEEA
AYRMGMGDAFTSGFAVALCHGNPINECVKFGNDVSLKVSQHRGSQKGLPYLKDFNLA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttagtaaagaacaacctagaatccttgtagtaggaagctcatctgtggatttg
gttttaaaaacagaacactatcctgagctgggagaaacagtgatggctaactcctccgaa
aatttcttcggtggaaaaggggctaatcaagccgtgggaactgcaagactaggagctagt
gtttactttgtaggatgtgtaggtatggatccttatgggcaacaaatattaagaaatctt
gtagaagaaaatgtaaatgtaggatttgttgtagaaaaccctgatatagaaactggtacg
gcatatgttaccacttctaaaggtaaaaatgccattgttgtagtcccatcagctaactat
gccttgagtcctaaacatctagaaaatcccaaacacctgtttgaaaccgctgatttagtt
ttggttcaactagaaatcacggatacggttatagaaaaagtattagagctttgcaaaaaa
aacggcactaaacttggcatatatgcggctcccgcaagaccactttccaaagaactaata
gaatatgctagttttatagtcgccaaaagcaacgatttatctacactttttggagatgac
cacagagatgcggttttacaaaaattgcctaataaactttttgtaagagatgataccaat
tctaccatatattacaacggttctgaaatgaaatatttccgtaacgacccagaagaagcg
gcttacagaatgggaatgggtgatgcctttacttcaggatttgctgttgctctatgtcac
ggaaatcccatcaacgaatgtgtaaaatttggcaacgatgtttcactaaaagtatctcaa
catagaggttcgcaaaaaggattgccttatttaaaagattttaatttggcttaa

DBGET integrated database retrieval system