KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0834Help
Entry
Riean_0834        CDS       T01363                                 

Definition
holliday junction DNA helicase subunit ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ran00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Riean_0834
Enzymes [BR:ran01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Riean_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
912586..913170
Genome map
AA seq 194 aa AA seqDB search
MIYSLRGIVQELSPTHLIIETGGVGYFVSVSVNTSKHFSIGKESLIYTQQIIREDAHLLY
GFSELKEKEMFNLLISVNGVGPASAMIMLSSLELREIAQAILSSNSAVLQKVKGIGTKTA
QRIIIDLKDKVLHFGADESDISTVIDNKVKEESLSALEVLGIPKKMSEKLANKILKQNPE
IQTEDLVKQILKNI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatttactctctacgaggtatcgttcaggagcttagcccaacccatttaattatagaa
actggtggtgtaggctactttgtaagcgttagtgtaaacacttctaaacacttttccatt
gggaaagaatctttaatctacacacaacaaatcattcgagaagacgctcacttattgtac
ggtttttcggagctcaaagagaaagaaatgtttaacctacttatttctgtaaatggtgta
ggaccagcctctgctatgattatgctttcctcactagaattaagagaaatagcacaagcc
atactctctagcaatagtgctgtattacaaaaagtaaaaggtataggcaccaaaactgca
caacgaattatcattgatttaaaagataaagtattgcattttggagcagatgaatctgat
atttccaccgttattgataataaagtaaaagaagaatcgttatctgcattagaagtttta
ggaatccctaaaaaaatgtcagaaaagttagccaacaaaattttgaaacaaaatccagaa
attcaaacggaagatttagtaaaacaaattttgaaaaacatttaa

DBGET integrated database retrieval system