KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_1346Help
Entry
Riean_1346        CDS       T01363                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Riean_1346
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Riean_1346
   00052 Galactose metabolism
    Riean_1346
   00500 Starch and sucrose metabolism
    Riean_1346
   00520 Amino sugar and nucleotide sugar metabolism
    Riean_1346
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Riean_1346
   00524 Butirosin and neomycin biosynthesis
    Riean_1346
Enzymes [BR:ran01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Riean_1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1479040..1480005
Genome map
AA seq 321 aa AA seqDB search
MTVSDLSSRMALGIDIGGTDTKFGLVNHRGEILGKGRIKTDYDEIDDFINALYKEIEPIL
EQHNAKSQLEGIGIGAPNGNYYKGTIENAPNLKWKGIVPLAEKMTAKFGVQCKVTNDANA
AAYGEMMFGAARGMKDFIMITLGTGVGSGVIANGQLVYGHDGFAGELGHTIVKPGGRKHW
STGSEGSLEAYASATGIAITAKKMRAEFPESILNNYPEEQINAKTVHECALAGDPTAIEV
FRYTGQKLGEALANFVMFSSPEAILLFGGVIKAGDFILKPTRMHMERNLLPIFRGKVKLV
FSELDEADAAILGASSLVWEK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttcggatttgtctagccgtatggctttgggaatagatataggaggtactgat
actaagtttggtttagtaaatcatagaggagaaatcctaggaaagggtagaataaaaaca
gactatgatgagatagatgattttataaacgctctttataaagaaatagaacctatacta
gaacagcataatgctaaaagccaattagaaggtataggcataggagcgcctaatggcaac
tactataaaggcaccatagaaaatgcccccaaccttaaatggaaagggatagtgcctttg
gcagagaaaatgacagcaaagtttggtgtgcagtgtaaggtaaccaacgatgctaatgca
gcagcttatggcgaaatgatgtttggggccgcaagagggatgaaagattttatcatgata
actctaggcactggggtcgggagtggagttattgctaacggtcagctagtgtacggtcac
gatggttttgcgggggaactagggcataccatcgtaaagccagggggaagaaagcactgg
agcacaggctcggaagggagcttagaggcttacgcatctgcaacaggcattgcgataacg
gctaaaaagatgagggcggagtttccagaatctatacttaataactacccagaagaacag
attaacgctaaaacagtacacgagtgtgctttggcaggagaccctacggcaatagaagtt
tttagatatacggggcaaaagttgggggaagcattggctaattttgtaatgttctcttct
ccggaggctattttattatttggtggggttataaaggcaggagattttatcttaaaacca
acaaggatgcatatggagagaaatttgttacctatatttagaggtaaagtaaaattagtt
tttagcgaactagacgaagcagatgcagcgatattaggtgcgagttctctagtttgggag
aagtag

DBGET integrated database retrieval system