KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_1363Help
Entry
Riean_1363        CDS       T01363                                 

Definition
uroporphyrinogen iii synthase hem4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Riean_1363
Enzymes [BR:ran01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Riean_1363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1495910..1496569)
Genome map
AA seq 219 aa AA seqDB search
MASSILLTKEINPEKRQLLLNEGLEVDTKDFIRIKFINTEKISLRNKTLIFTSANGVEGF
FKNGFDAPHSSVICVGGKTESKLAEKGIKTLHTAKNAEELASFILQQQWDNPDFVHFCGN
LALDTLEKSIANHNANYIKKIVYETELLYPTLNKKYDALVFFSPSGVRSFVKNNSITDEM
VFCIGNTTALEVAKYTSQKPIISTKQNLNDLLSLVKSVV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggctagttctattctcttgactaaggaaatcaatcctgaaaaacgccaactcctgtta
aacgaaggactagaggttgataccaaagattttattagaattaaattcatcaataccgaa
aagattagtctgcgtaataaaacacttatattcactagtgcaaatggggtagaaggcttt
tttaaaaacggttttgatgcacctcattcatctgtgatttgtgtaggtggcaaaactgaa
agcaaacttgcagaaaaaggcatcaaaactctacatacggctaagaatgccgaagaatta
gcctcgtttatacttcaacagcaatgggataatcctgattttgttcacttttgtggcaac
cttgcattggatactttagaaaaaagcatcgctaatcacaatgcgaattatataaagaaa
atagtttacgaaaccgaacttctataccctactcttaacaaaaaatatgatgctttagtt
ttttttagtccaagtggagttcgtagctttgtaaaaaataattctataaccgatgaaatg
gtcttttgtataggaaatactaccgctttggaagtggcaaaatacacctcacagaaacct
ataattagcaccaagcaaaacctcaacgatttgcttagtctagtaaaatcggtagtctaa

DBGET integrated database retrieval system