KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_1435Help
Entry
Riean_1435        CDS       T01363                                 

Definition
GTP cyclohydrolase i (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Riean_1435
Enzymes [BR:ran01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Riean_1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1566879..1567544)
Genome map
AA seq 221 aa AA seqDB search
MNNHFDNDDDVFTGKEHTPLRADAFEKTPEEKIAIIEKHFAEIMQTLGLDMTDDSLKDSP
KRVAKMYVNEIFGGLLPENKPGISTFSNKYKYRQMLVEKDITVYSFCEHHFLPIIGRAHV
AYISNGEVIGLSKINRIVDYYAKRPQVQERLTMQIVDALKEALGTNDVACIIDAKHLCVN
CRGIKDTASSTITAELSGIFRTNPITRQEFLHYVGSHAKLD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccattttgataatgatgacgatgtgtttacaggcaaagagcacacaccctta
agagctgatgcctttgagaaaacacctgaagaaaaaattgccattatagagaagcatttt
gccgaaatcatgcaaactttagggctagatatgacggatgattccctaaaagactctcct
aagcgagtagccaaaatgtatgtaaatgagatttttggaggactacttcctgaaaacaaa
ccaggtatctctacttttagcaacaagtataaatacagacaaatgctcgttgaaaaagac
attacagtttattctttttgtgagcatcattttttgcctatcattggcagagcccatgtg
gcttatatctctaacggagaggtgattgggttatccaaaatcaatagaattgtagattac
tatgccaaacgcccacaagtgcaagaaagactcactatgcaaatagtagacgctctaaaa
gaggctctcggcactaatgatgtggcttgtattattgatgctaagcacctttgtgttaat
tgtagaggcatcaaagacacggctagttctaccattacagcggaacttagcggcatcttt
agaactaaccctatcactagacaagagtttctgcactatgttggtagtcatgcaaaacta
gattaa

DBGET integrated database retrieval system