KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_1674Help
Entry
Riean_1674        CDS       T01363                                 

Definition
nitrous oxide reductase apoprotein (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Riean_1674
Enzymes [BR:ran01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Riean_1674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1847182..1849188)
Genome map
AA seq 668 aa AA seqDB search
MKINKILGYSALFLGSIYALESCKPKGTENAVAGDAAEKVYVAPGKHDEFYNFVSGGFNR
QMGVYGLPSGRLLKVVPIFSVNPENGYGYSEETKPMLETSHGFIPWDDQHHLELSQTNGE
VDGRWIFANANNTPRIARVDLSSFKTVEVLELPNSAGNHSSPFITENTEYVVAGTRFSVP
TDDANGDVPINSFKENFKGVISFVKVDKTTGEMKLAFQIEAPGVNFDLSHAGKGKSHGWF
FFSCYNSEQANSLLEVNASQFDKDFIMALDWKKAEEYVKAGKGRKVKTQYAHNKWNEETH
TGSSKMEQEVTVLSAKELKDLCYFMPTPKSPHGCDIDPTGEYIVGSGKLAALIPVHSFSK
MLNAIKNKEFAGEYDGISILKYESTLHGEVQKPGLGPLHTEFDDKGYAYTSFFVSSEVVK
WDIKTLKVLDRQPTFYSVGHLMIPGGDSKKPFGKYLVAYNKITKDRFLPTGPELAQSAQL
YDISGDKMKLLLDFPTFGEPHYAQALPAKLIADKQVKFYDISKNKHPYVTKGEGESRVVR
DGNKVHVYMTSIRSHFAPDNIEGIKVGDEVYFHVTNLEQDWDVPHGFAIKGAENAELLIM
PGETCTLKWIPKKAGMFPMYCTDFCSALHQEMQGYVRVSPAGSSTPLLFSLNNKADNAQG
PVKKAETK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaataaaatattaggctattcggcactatttctagggagcatctacgcccta
gaaagttgtaaacccaaagggacggaaaatgctgtagctggtgatgcagcagaaaaagta
tatgtggcaccgggtaaacatgacgaattttataattttgtcagcggtggttttaacaga
caaatgggagtctatggtttacctagcgggagattactaaaagtagttcctatattctcc
gtaaatcccgaaaatggctatggttacagtgaagaaactaagcccatgttagaaacttca
catggttttattccttgggatgaccagcatcaccttgaactttcacaaaccaatggagaa
gttgatgggcgttggatttttgctaacgctaataacacacctcgcatcgcaagagtagac
ctttctagctttaaaacagtagaagttttagaactaccaaactccgcaggaaatcattca
tctccttttattacagaaaatacagagtatgtagtagctggaactcgtttttctgtacct
actgatgatgctaatggtgatgtacccattaatagttttaaagaaaattttaaaggcgta
atttcctttgtaaaagtagataaaacaacaggagaaatgaaactggcttttcaaatagaa
gctcctggtgtcaatttcgacttatctcatgcaggcaaaggtaaatctcatggctggttc
ttcttctcttgttataattcagagcaagctaatagcctattagaagttaacgcttctcaa
tttgacaaagatttcatcatggctttagactggaaaaaagcagaagaatatgtgaaagca
ggtaaagggagaaaggtaaaaacccaatacgcacacaacaaatggaatgaagaaacccat
acaggtagttctaaaatggaacaagaagtaacggtgctgtcagctaaagaacttaaagat
ttatgctactttatgccaacacctaaatcaccacatgggtgtgatatagaccctacaggt
gagtatattgtaggttcgggtaaattagcagctctgattcctgtacatagcttcagtaaa
atgctgaatgctatcaaaaacaaagagtttgctggagaatatgacggcatttctattcta
aaatacgaatctaccctacacggagaagttcaaaaacctggtttaggtcctcttcataca
gaatttgatgataaaggttatgcttatacttcattctttgtttcttcggaggttgtaaaa
tgggatatcaaaactctcaaagttttagatcgtcaacctacattctattccgtaggacat
ttaatgattccaggtggagactctaagaaacctttcggtaaatatttggtagcttataac
aaaattaccaaagatagatttttacctacaggtccagaactagctcagtctgcacagtta
tatgacattagtggtgataagatgaaacttttactagacttccctacatttggagagcct
cattacgcacaagctcttcctgcaaaactcatcgcagataagcaagtaaaattctatgat
atttctaagaacaaacacccttatgtaaccaaaggtgaaggtgaatctagagtagttaga
gatggtaataaagttcatgtttacatgacctccatccgttctcattttgctcctgataat
attgagggtattaaagttggtgatgaagtttatttccatgtaaccaatctggaacaagac
tgggatgtccctcacggatttgcgattaagggtgcagaaaatgcagaactcctcattatg
cctggagaaacttgcacacttaagtggattccaaaaaaggcaggaatgttccctatgtac
tgtactgacttctgctctgctctacaccaagaaatgcaaggctatgtaagagtttcacca
gcaggaagttcaacacctctgttgtttagccttaacaataaagcagacaacgcccaaggt
ccagtaaaaaaagctgaaactaaataa

DBGET integrated database retrieval system