KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_1701Help
Entry
Riean_1701        CDS       T01363                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Riean_1701
Enzymes [BR:ran01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Riean_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1874379..1875236
Genome map
AA seq 285 aa AA seqDB search
MKTYAGIPEENASLENSKVMLVTVPYDGTSTWGKGADKGPELFLDASENMELYDIETGTE
PYLEGVYLAGEVTEDSSPEAMTEAVYQKTKELLKHEDKLFTLFGGEHSVSIGSIRAVGEK
YENLTVLQLDAHTDLRPEFHGSTSNHACAVFEASQKHNLVQVGIRSMDAEEMQYVPKGQC
FWAHEIAQNPNWIDEVLEKVSGNVYITIDLDAFDPSIAPSTGTPEPGGLAWYPTLELLKK
VFEKCNVVAFDIVELMDSPMAKPTAFLAAKLYYKMLAYYHLANKK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatacgcaggtattccagaggaaaatgcaagtttagaaaactcaaaagtaatg
ttagttaccgttccttatgacgggacatctacttggggtaaaggagctgataaaggtcca
gaactatttttagatgcttccgaaaatatggagctttacgatattgagacaggtacagaa
ccttatttagaaggcgtgtatttagcaggtgaggtaacggaagacagctctccagaagct
atgacggaagcggtgtaccaaaaaacaaaagaactcctaaaacacgaagataaattattt
actctttttggtggggagcattcggtatctattggctctatccgtgcggtaggagagaag
tatgaaaatcttactgtattacaactagacgctcatacagaccttcgcccagagtttcac
gggtctacatctaatcacgcttgtgcagtgtttgaagctagtcagaagcataatctagtg
caagtaggtatccgttctatggacgcagaagagatgcaatatgtaccaaaaggacagtgt
ttttgggctcacgaaatagctcaaaatcctaattggatagatgaggtattagaaaaagtg
tcaggaaatgtttatattacgatagatttagatgcgtttgacccttctattgctccatct
acaggaacaccagaaccgggaggtttagcttggtatcctactttagagctcctaaaaaag
gtgtttgaaaaatgcaatgtagtggcttttgatattgtagaactcatggactctccaatg
gcgaaacctacggcatttttagcggcaaagctatattataagatgttggcttattatcat
ttggctaacaagaaataa

DBGET integrated database retrieval system