KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_1733Help
Entry
Riean_1733        CDS       T01363                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ran00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:ran02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1908744..1910561)
Genome map
AA seq 605 aa AA seqDB search
MKNILKQVAVFGLLFSVKLFFSQNYEKYSLENGFSHNDYLQTSPLIESFTLGFGLIEVDV
HWDGNNLMVAHDASEIQNDRTLETLYIKPLSKLWVEGKGRPLKLLIDLKTPWQDTLPQIQ
NLLETYPNLHQQVQFVITGNIPPKELFSQYPYYLMFDGRIGERYSQNELAKIAIISDDFK
KYTQWNGKGYPKAREKQTILETIDKVHSLGKPIRFWGSPDEINAWHTLMVYNVDYISTDQ
PKALAEVLERLAKSSYTSKVSHQPYQPKYKNFDKKKAKNILLFIPDGVSLPQLYAAYTAN
GNNLNIFKMPYSGVVNTSSADSFITDSAPGSTAFSSGVKTNNAYVGVDKKGNPLELLPDI
LDKYGKVSAVVTTAEVTDATPADFYAHTTNRNDHTKIISFFPTSKLKYLAGSPFSGWSEE
IENHLKNQGIKIAKSLDCDLSHSKKTLILDQTAEKMKLDKRNNWLQQAYSLFLNKLNKNK
QGFFFLIEASQTDVGGHWRDLPYAVSELQEMDNIVGSALKFADENEETLVVVVGDHETGG
LTLLGGNPKQNKIFGQFATMDHTALPTIVFAYGPGAEQFTGFMDNTDVFYKILKALNMQH
ENNHH
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatactaaaacaagtagcagtcttcggactgctattttcagtgaagctattt
ttctctcaaaattatgaaaaatacagcttagaaaacggattttctcacaatgattacttg
cagacctcccctctaatagaaagtttcaccttaggatttgggttaatagaagtagatgta
cattgggacggcaataatcttatggttgcccacgatgcctcagaaatacagaatgataga
acactagaaaccttatatataaaaccactctcaaaactttgggttgagggaaaaggacgg
ccactgaaacttctaattgacctaaaaactccttggcaagatactttacctcaaattcaa
aacctattagagacatatccaaatctgcatcaacaggttcaatttgtaattacaggcaat
ataccacctaaagaattattttctcaatatccctattatttaatgtttgatgggagaatt
ggtgaaagatattcccaaaacgaactagcaaaaattgcaataattagtgatgatttcaag
aagtacactcaatggaatggcaaaggctatcccaaagctagagagaaacaaactattctt
gagactatagacaaagttcactccttaggaaaacctattagattttggggaagcccagat
gaaatcaatgcgtggcatacactaatggtatataatgtagattatatttcaacggaccaa
cctaaagccctagcagaagttcttgaacgactagccaaaagtagctatacttccaaagtt
tcccaccaaccctatcagcccaaatacaaaaactttgataaaaaaaaggcaaaaaatatt
ttgctttttataccagatggcgtctctttaccacagctatacgctgcatataccgccaat
ggtaacaatctgaacatcttcaaaatgccttattctggggtagtaaacacttcatcagca
gactcttttatcacagattctgcacctggctctacggctttttctagtggggttaaaact
aataatgcctatgttggagtagataaaaaaggaaatcccctagaactattaccagatatt
cttgataaatatggcaaagtaagtgccgtggtaacaacagcagaggtaaccgatgctact
cctgcagatttctacgcccatactactaaccgtaatgaccacaccaaaatcatttcattt
ttcccaacttctaagctgaaatatctagcaggttcaccgttttcaggatggtcagaagag
atagaaaatcacctaaaaaatcaaggtatcaaaatagcaaaatcgctagactgtgattta
tctcactcaaaaaagactttgatacttgaccaaacagcagaaaaaatgaaactagacaag
agaaacaactggctacaacaagcctactctcttttcttaaacaaattaaacaaaaacaaa
caaggttttttctttttaatagaagccagtcaaacagatgttggtgggcattggcgagac
cttccttatgctgtgtctgaactgcaagagatggataatattgtaggttcagcattgaaa
tttgctgatgaaaatgaagaaactctagttgtagtagtaggagaccacgaaacaggagga
cttacattacttggaggcaaccctaaacaaaataaaatatttggacaatttgccacgatg
gatcacacagctctacctacaatagtatttgcctatggtcctggagccgaacaattcact
ggatttatggataacactgatgttttttataaaatattaaaagctcttaacatgcaacat
gaaaacaatcatcactaa

DBGET integrated database retrieval system