KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0019Help
Entry
Rahaq2_0019       CDS       T01770                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rahaq2_0019
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rahaq2_0019
   00600 Sphingolipid metabolism
    Rahaq2_0019
Enzymes [BR:raq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Rahaq2_0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(19160..21286)
Genome map
AA seq 708 aa AA seqDB search
MENQIVHLTAAHTSLIVRCTPFAEILYWGKRLSQFSADDIISLSRAVPNGRIDVEAPVNF
SADTGRGSFGTPGMEGHRDGLDWSPVFNTTQVKHNGNQLTLITEDPLAGLQFRSELRLDD
SGVLQARNSLTNLKPGTYQVTRLAVTLPLPERAAEVMAFHGRWIKEFQPHRTQLDHGGII
QENRRGKTSSEYFPAMMIGHPGFSEEQGEIWGIHLGWSGNHRLRADIKIDGRRLVQAEAL
YFPGEQRLKQGETLETPWLYASYSASGLNRMSQQFHRFVREQILRFPDEKPRPVHLNTWE
GIYFDHDPDYIMQMATESAALGVERFIIDDGWFRGRDHDRAALGDWYLDEKKYPNGLKPV
IDHVKKLGMEFGIWVEPEMINPDSDLYRAHPDWLLALPGYQQPSGRHQYVLDLNNPQVFD
YLVERMSWLLGEHDVDYVKWDMNREIVQPGHDGRAALTAQTQQFYRLLDVLGERFPQIEF
ESCASGGGRIDFEVLKRSHRFWTSDNNDALERQKIQRGMSYFFPPEVMGSHIGNKLCHAT
SRQHSIEFRGLTALFGHMGIELDPVKEGEAERAGFAKYTRLHQQLRPLLHSGDVYRVDTH
DGTMLINGVVSETRDSAVFLVSQLAMPTWSLPGVLRVPGLKPDARYRVTVLDEPPLLAGG
GSGHTMRVQPAWLHESPVLSGEWLANAGLTLPVLDPESALLLGFEEVR
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccagatcgtccatttaaccgccgcgcacaccagcctgatcgtccgctgcacc
ccgttcgccgaaatcctttactggggaaagcgcctcagccagttctcagcagatgacatc
atttccctgagccgcgcagtgcccaatggccggattgatgtggaagcgccggtaaatttc
agcgcggataccgggcgcggttccttcgggacgccgggcatggagggccatcgcgacggg
ctggactggtcgccggtgttcaataccacgcaggtgaagcacaacggaaaccagctcacc
cttatcaccgaagatccgcttgccggtctgcaatttcgcagcgaattgcgcctcgacgac
agtggcgtgttgcaggcgcgcaacagcctgaccaatctcaaacccggcacctatcaggtg
acgcggctggcagtgacactgccgctgccggaacgcgccgccgaagtgatggcttttcat
ggccgctggataaaagaatttcagccgcaccgcacgcagcttgatcacggcggcatcatt
caggaaaaccgtcgtggcaaaacctcctccgaatatttcccggcgatgatgatcggtcat
ccgggtttcagcgaagaacagggagaaatctggggaatacatctgggctggagcggcaac
catcgtctgcgcgctgatatcaaaatcgacggccgccgtctggtgcaggccgaagcatta
tatttccccggcgaacagcgccttaaacaaggcgaaacactggaaaccccgtggctgtac
gccagttattccgccagcggtctgaaccgtatgagccagcagttccaccgttttgtacgt
gaacagattttgcgctttccggatgaaaaaccgcgtccggtgcacctcaatacctgggaa
gggatttatttcgatcacgatcctgactacatcatgcagatggcgacagaatccgccgcg
ttgggcgttgaacgcttcattatcgacgacggctggttccgtggtcgcgaccatgaccgt
gccgcactcggtgactggtatctcgacgagaaaaagtacccgaacggcctgaaaccggtg
attgaccatgtcaaaaaactcggcatggaatttggtatctgggtcgagccggaaatgatt
aacccggattccgatttataccgtgcgcatcctgactggctgctggcgttgcccggttat
cagcaaccgagcgggcgtcatcagtatgtgctcgatctgaacaatccgcaggtctttgat
tatctggtggaacgcatgagctggctgctcggcgagcacgacgtggattacgtgaaatgg
gacatgaaccgcgaaattgtgcaaccggggcatgacggccgcgcggcgctgacggcgcag
acgcagcagttttaccgtttgctcgacgtgctgggtgaacgcttcccgcagattgaattt
gaatcctgtgcatccggcggtggtcgcattgattttgaggtgctcaaacgcagccaccgt
ttctggacatccgacaataacgacgcgctggagcggcagaaaattcagcgcggcatgagc
tatttcttcccgccggaagtgatgggatcgcatatcggcaacaagctgtgccacgccacc
tcacgccagcacagcatcgaattccgtggcctgaccgccctgttcggccatatgggcatt
gagctggatccggtgaaagaaggcgaggccgaacgcgccggtttcgccaaatacacccgc
ctgcatcagcagcttcgtccgttattgcacagcggcgatgtttaccgcgtggatactcat
gacgggacgatgctgataaacggcgtggtcagtgaaacacgcgacagcgcggtattcctg
gtcagccagctggcaatgccgacctggtcattgcccggcgtattgcgggtgccggggctg
aaacccgatgcgcgttatcgcgtgacggtgctggatgaaccgccgctactggcgggcggc
ggcagcggccacaccatgcgcgtacaaccggcgtggctgcatgaatctccggtattgagc
ggagaatggctggcaaatgccgggctgacgttgccggtgctggatcctgaaagcgcactg
cttctgggtttcgaagaagtcagataa

DBGET integrated database retrieval system