KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0124Help
Entry
Rahaq2_0124       CDS       T01770                                 

Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rahaq2_0124
Enzymes [BR:raq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Rahaq2_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(128074..129087)
Genome map
AA seq 337 aa AA seqDB search
MLAFRRYGLVLWFSLIFAFFSSAVMAQDPGWSAYKSRFLMPDGRIIDTANKNVSHTEGQG
FSMLLAVFNDDQATFDKLWQWANNTLYRKDIGLYSWRYDPNSTPHVADINNASDGDTLMA
WALLLAGDKWNDPRYTKASEKLQAALITYNVIDYAGYKVMLPGVKGFNQTSNVTVNPSYF
IFPAWQAFYAHSHLKVWKDLDESSTAMLSKMAFGDFRLPTDWVDMQADGTLKPASRWPTR
FSYDAVRIPLYLGWAHPGSPQLAPFILWWQKSPRDATPAWIDVMTGTKAGYNMSPGLLAV
RDFTMANAGAISPNLAPKDDYYSSTLQLLSWWASHKG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttggcatttcggcgctacggtctggtgctgtggttcagccttattttcgcgtttttc
agctccgctgtaatggcgcaggatccgggctggtctgcgtataaaagtcgctttctgatg
ccggacgggcgaatcattgataccgccaataaaaacgtcagtcacaccgaaggtcagggt
ttcagtatgctgctggcggtgtttaacgatgatcaggcgacgttcgacaagctgtggcag
tgggcaaacaacacgctgtaccgcaaagatatcggcctgtattcatggcgttatgaccca
aacagcacgccgcatgtggcagatatcaacaacgcctctgatggcgatacgctgatggcg
tgggcgttgctgctggcgggcgacaagtggaacgatccgcgttacaccaaagcctctgaa
aaattgcaggcggcgctgatcacatacaatgtgattgattacgcgggttacaaagtcatg
ctgccgggtgtaaagggctttaaccagaccagcaacgtgaccgtcaatccgtcctatttc
atcttcccggcctggcaggcgttttatgcgcacagtcatttaaaggtatggaaagatctg
gatgaaagcagcacggcgatgctcagcaaaatggcgtttggcgatttccgcttgccgaca
gactgggtcgatatgcaggccgatggcaccctgaaaccggccagccgctggccaacgcgg
ttcagttacgacgccgtgcgtatcccgctctacctcggctgggcgcatccgggcagcccg
caactggcaccgttcatcctgtggtggcaaaaatcgccacgtgacgccacgcccgcctgg
attgatgtcatgaccggcaccaaagcgggctacaacatgtcaccgggattattagccgtg
cgcgatttcaccatggccaacgccggtgccatcagcccgaatctggcaccgaaagacgat
tactactcttccaccctgcaactgctgagctggtgggcgagtcataaagggtaa

DBGET integrated database retrieval system