KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0124Help
Entry
Rahaq2_0124       CDS       T01770                                 

Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:raq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(128074..129087)
Genome map
AA seq 337 aa AA seqDB search
MLAFRRYGLVLWFSLIFAFFSSAVMAQDPGWSAYKSRFLMPDGRIIDTANKNVSHTEGQG
FSMLLAVFNDDQATFDKLWQWANNTLYRKDIGLYSWRYDPNSTPHVADINNASDGDTLMA
WALLLAGDKWNDPRYTKASEKLQAALITYNVIDYAGYKVMLPGVKGFNQTSNVTVNPSYF
IFPAWQAFYAHSHLKVWKDLDESSTAMLSKMAFGDFRLPTDWVDMQADGTLKPASRWPTR
FSYDAVRIPLYLGWAHPGSPQLAPFILWWQKSPRDATPAWIDVMTGTKAGYNMSPGLLAV
RDFTMANAGAISPNLAPKDDYYSSTLQLLSWWASHKG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttggcatttcggcgctacggtctggtgctgtggttcagccttattttcgcgtttttc
agctccgctgtaatggcgcaggatccgggctggtctgcgtataaaagtcgctttctgatg
ccggacgggcgaatcattgataccgccaataaaaacgtcagtcacaccgaaggtcagggt
ttcagtatgctgctggcggtgtttaacgatgatcaggcgacgttcgacaagctgtggcag
tgggcaaacaacacgctgtaccgcaaagatatcggcctgtattcatggcgttatgaccca
aacagcacgccgcatgtggcagatatcaacaacgcctctgatggcgatacgctgatggcg
tgggcgttgctgctggcgggcgacaagtggaacgatccgcgttacaccaaagcctctgaa
aaattgcaggcggcgctgatcacatacaatgtgattgattacgcgggttacaaagtcatg
ctgccgggtgtaaagggctttaaccagaccagcaacgtgaccgtcaatccgtcctatttc
atcttcccggcctggcaggcgttttatgcgcacagtcatttaaaggtatggaaagatctg
gatgaaagcagcacggcgatgctcagcaaaatggcgtttggcgatttccgcttgccgaca
gactgggtcgatatgcaggccgatggcaccctgaaaccggccagccgctggccaacgcgg
ttcagttacgacgccgtgcgtatcccgctctacctcggctgggcgcatccgggcagcccg
caactggcaccgttcatcctgtggtggcaaaaatcgccacgtgacgccacgcccgcctgg
attgatgtcatgaccggcaccaaagcgggctacaacatgtcaccgggattattagccgtg
cgcgatttcaccatggccaacgccggtgccatcagcccgaatctggcaccgaaagacgat
tactactcttccaccctgcaactgctgagctggtgggcgagtcataaagggtaa

DBGET integrated database retrieval system