KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0226Help
Entry
Rahaq2_0226       CDS       T01770                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:raq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237534..239717
Genome map
AA seq 727 aa AA seqDB search
MSVLPDQHVINQIISGHYADPFSLLGMHSVAAGLEVRALLPDADQVWVIDVEKGKQVAEL
RRYDDRGFFVGLIPRRKNAFRYKLEVRWGENLQVIDDPYRFGTLLQELDIWLLAEGTHLR
PYEKLGAHLQTLDDVEGVSFAVWAPNAMRVSVVGEFNFWDGRRHPMRQRRENGIWELFIP
AVREGQLYKFEIIDCRGQISLRADPYAFEAQMRPDTASCVRKLPDVVPHSESRKKANALN
QPVSVYEVHLGSWRRHADDNFWLSYGELAEQLVSYAKWMGFTHIELMPVNEHPFDGSWGY
QPLGMYAPTRRFGTPMEFKAFVEAAHHAGLNVILDWVPGHFPSDTYGLAQFDGTALYEYA
DPREGYHQDWNTLIYNYGRHEVRNYLAGNGFYWIERFGIDGLRVDAVASMIYRDYSRKAG
EWIPNYYGGRENLEAISFLKYTNQTIGRELGGAVTLAEESTDYPGVTMPPDANGLGFHYK
WNMGWMHDSLTYMQLDPVHRKYHHNLMTFGVLYAYSENFILPLSHDEVVHGKKSLLDKMP
GDVWQKFANLRAYYGFMWAHPGKKLLFMGNEFAQGREWNFDASLDWHLLDDPGGWHSGVQ
HLVRDLNLTYRANAPLYELDYNPRGFEWLVVDDHENSIFAFARRDENGGEVIVISNFTPV
PREHYRIGISRPGCYHEILNTDSHFYRGSNVGNGGDVYSENIGHHQREHSISVTIPPLAT
VYLRREA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtacttcccgatcagcacgtcattaatcaaattatatctggccactacgctgat
cctttttctcttttgggtatgcattctgtggccgccgggctggaagtgcgcgccctgttg
ccggatgccgatcaggtctgggttattgatgtagaaaaaggtaaacaggtggcggaactg
cgtcgttatgacgatcgtggtttctttgtcggcctcatcccgcgccgtaaaaatgcgttt
cgttacaagctggaagtccgctggggcgagaatctccaggtgattgatgatccgtaccgg
ttcggcacactgttgcaggaactcgatatctggctgctggcagaaggtacacatttgcgg
ccatatgaaaaactcggtgcacatctgcaaacgctggatgacgtcgagggtgtcagtttt
gccgtctgggcaccgaacgccatgcgggtttccgtggtcggtgaattcaacttctgggac
ggccgccgtcacccgatgcgtcagcgtcgcgaaaacggtatctgggaactctttatcccc
gccgtccgtgaaggtcagctgtataaattcgaaattatcgactgccgcgggcagatcagc
ctgcgcgccgacccgtatgcgtttgaggcgcagatgcgtccggacaccgcttcgtgcgtg
cggaaattaccggatgttgtgccgcattcagaaagcagaaagaaagccaatgcgctgaat
cagccggtttccgtgtatgaagtgcatctgggttcctggcgtcgtcatgccgatgataat
ttctggctcagctatggcgaactggctgagcaattagtctcgtacgccaaatggatgggc
tttacgcacatcgaactgatgccggttaacgaacatccgttcgacggtagctggggctat
cagccacttggcatgtatgcgccgacccgtcggttcggtacaccgatggaattcaaagcc
tttgtcgaggccgcacatcatgccgggctgaacgtcattctcgactgggtgccgggacat
ttcccgagcgacacctatggtctggcgcagtttgacggcaccgcgctgtacgaatatgcc
gatccgcgtgaaggctatcatcaggactggaacacgctgatttataactatggccgccat
gaagtgcgtaactatctggccgggaatggtttttactggattgaacggtttggcattgat
ggcctgcgtgtcgatgcggtggcttccatgatttaccgcgattacagccgtaaagccgga
gagtggatcccgaattattacggcggtcgcgaaaacctcgaagccatttccttcctgaaa
tataccaaccagaccattggccgcgaactcggcggtgcggtgacgctggcagaagaatcc
accgattatcccggcgtcaccatgccaccggatgccaacgggctgggtttccattacaaa
tggaatatgggctggatgcatgattccctgacctatatgcagcttgatccggttcaccgc
aaataccatcacaatctcatgacattcggcgtactttacgcctacagcgagaacttcata
ttgcccctgtcgcacgacgaagtggtgcacggtaaaaaatccttgctggataaaatgccc
ggcgacgtctggcagaagttcgctaacctgcgcgcctattacggctttatgtgggcgcat
ccgggtaaaaaactgctgtttatgggcaatgaatttgcgcaggggcgcgagtggaatttc
gacgcaagtctcgactggcatctgctcgacgacccgggtggctggcacagcggcgtacaa
catctggtacgcgatctgaacctgacctatcgggccaacgcgccgttgtatgagctcgat
tacaacccgcggggctttgaatggctggtggtcgacgatcacgaaaactcgattttcgcc
tttgcccgccgcgatgaaaatggcggcgaagtgatcgttatcagtaactttacgccggtc
ccgcgcgagcactatcgcatcggtatcagccgtcccgggtgttatcacgaaattcttaat
acggattcgcatttctatcgtggcagcaatgtcggcaacggcggcgatgtttacagtgaa
aatattggccatcatcagcgtgaacactcgatcagcgtgactattccaccgctggcgacg
gtttatttgcgaagggaggcgtaa

DBGET integrated database retrieval system