KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0476Help
Entry
Rahaq2_0476       CDS       T01770                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:raq00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486138..486884
Genome map
AA seq 248 aa AA seqDB search
MLEQICQLARDAGDAIMAVYDGEQPLDARHKKDDSPVTAADIAAHNVIKAGLQTLDPQTP
MLSEEDPQSWGERQNWTRYWLVDPLDGTKEFLKRNGEFTVNIALIEDGIPVLGVVYVPVT
KVMYSAAEGKAWKEEQGVRQQIAVKEAHPPLVVVSRSHFSNDPELQDYLAQLGEHQTVAI
GSSLKFCLVAEGTAQLYPRFGPTNIWDTGAGHAVALAAGAQVHDWKGQTLDYVPRESFLN
PGFRVSLF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaaatttgtcagttagcgcgcgatgcgggtgacgcgatcatggcggtgtat
gacggtgaacaaccgctggatgcgcgccataaaaaagacgattcgccggtcaccgcagca
gatattgcagcgcacaacgtgattaaagctggcctgcaaacgctggatccgcaaacgccg
atgctgtcggaagaagacccgcaaagctggggcgagcgccagaactggacgcgttactgg
ctggttgatccgctggacggtacgaaagaattcctgaaacgtaacggtgaattcaccgtg
aatattgcgctgatcgaagacggtatcccggtgttgggcgtggtgtacgtgccggtgacc
aaggtgatgtacagcgccgcagaaggcaaagcctggaaagaagagcagggggtacgtcag
cagattgccgtgaaagaagcgcatccgccgctggtggtcgtcagccgttcgcacttcagc
aatgaccctgaattgcaggattatctggcgcaactgggcgaacatcagacggtagccatc
ggttcgtcgctgaaattctgtctggtggcggaaggcacagcacagctttatccgcgcttc
gggcccaccaatatctgggataccggtgccggtcatgctgtcgcgctggccgccggagcg
caggtacatgactggaaaggtcagacgctggactacgtgccacgtgaatcattcctcaat
ccgggcttcagagtgtctttattctga

DBGET integrated database retrieval system