KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0666Help
Entry
Rahaq2_0666       CDS       T01770                                 

Definition
cystathionine beta-lyase
Orthology
K01760  
cystathionine beta-lyase [EC:4.4.1.8]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Methionine biosynthesis, apartate => homoserine => methionine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:raq01230]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:raq00270]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:raq00450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(707057..708250)
Genome map
AA seq 397 aa AA seqDB search
MSSKKIETALVSAGRDKKFTQGSVNAVIQRASSLVFDTVADKKHATANRANGELFYGRRG
TLTHFSFQEAMVELEGGAGCALYPCGAAAVSNAVLSFVSSGDHILVAGSAYEPTQDFCEK
VLKKLGVSTTYFPSTVGAALGTLMQPNTKVVFLESPGSITLEVPDIPAMVQAVRAVNPDV
VIMIDNTWAAGILFKALEFDIDISIQAGTKYIVGHSDAMIGTAVSNARCWEQLREHSYLM
GQMADADTAYVASRGLRTLAVRLKQHAESSLRIARWLAERPEVAVVNHPALPGSKGHEFW
KRDFTGSCGLFSFVLKQRLSKQQLSDYLDHFDHFSMAYSWGGFESLVLANQPEEIQAIRP
AETVDFSGTLVRLHIGLENCDDLIADLSTAFERITTS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctaagaaaattgaaaccgcgctggtcagcgccggacgtgacaagaagttcaca
cagggttcagtgaatgccgtgatccagcgcgcctcgtcgctggtgtttgataccgtggct
gacaagaaacacgccaccgccaaccgcgccaatggtgagctgttctacggacgccgtggc
acactgacgcatttctccttccaggaggcgatggtggagctggaaggcggcgcgggctgt
gcgctgtatccgtgtggcgcggcggccgtcagtaacgctgtgctgtcatttgtcagcagc
ggcgaccacattctggtggccggttccgcctacgaaccaacgcaggatttctgcgaaaaa
gtgctgaaaaaactcggtgtatccaccacttattttccgtccactgtcggtgcagcgtta
ggtacgctgatgcaacccaacaccaaagtggtgttcctggaatcgccgggctcgatcacc
ctggaagtcccggatattccggcgatggtgcaagccgtgcgggcagtgaacccggacgtt
gtcatcatgatcgacaacacgtgggcggcgggtattctgtttaaagcgctggaattcgat
atcgatatttcgattcaggcgggcaccaaatatattgtcggccattccgatgccatgatt
ggcaccgctgtgtcgaacgcacgttgctgggagcaactgcgggaacattcgtatctgatg
ggccagatggccgatgccgacaccgcgtatgtggcgagccgcggtttgcgcaccctggcc
gtgcggctgaaacaacatgcagaaagcagtctccgcattgcgcgatggctggcagagcga
ccggaagtggcagtggtcaatcatcccgcattacccggcagcaaaggccatgaattctgg
aaacgtgatttcaccggcagttgcggactgttctctttcgtgctgaaacagcgtctgagc
aaacagcaactttccgactacctcgatcacttcgaccatttcagcatggcctattcctgg
ggcggttttgaatcactggttttggccaatcagccggaagaaattcaggcgatacgtccg
gctgaaaccgtggatttcagcggtacgctggtgcggttgcatatcgggctggaaaattgt
gacgacctgatcgccgatctttcaacagcctttgaacggattacgacatcctga

DBGET integrated database retrieval system