KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0701Help
Entry
Rahaq2_0701       CDS       T01770                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
748804..749430
Genome map
AA seq 208 aa AA seqDB search
MVNKPMYNLLEQLRQQGIHDEKLLHAIEAVPRERFVDEAFQHKAYENTALPIGSGQTISQ
PYTVARMTELLRLEPSSRVLEIGTGSGYQTAILAHLVEHVFSVERIKGLQWQAKRRLKQL
DLHNVSTRHGDGWQGWPSRGPFDAIIVTAAPPEIPQDLLQQLDDGGVLILPVGEENQTLQ
RVTRRGDEFIAETIEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtgaataaaccgatgtacaacctgctggagcaactacgccagcagggcattcatgat
gaaaaactgttgcatgccatcgaagctgtgccgcgcgagcgtttcgtggatgaggcattt
cagcataaagcctacgaaaacactgcattacctattggctcaggccagaccatttctcag
ccttataccgtggcgagaatgactgaattactgcgccttgagccttcttcccgggtgctg
gaaattggcaccggttcaggctatcagactgccattctggcccatctggttgaacacgtt
ttctcggttgagcgcatcaaagggttgcagtggcaggcaaaaagacgcctcaagcagctc
gatttgcataatgtctccacccgtcatggtgacggctggcagggctggccttcgcgcggc
ccgtttgatgccattattgtcaccgctgcacctccagaaatacctcaagatttgctgcaa
caactcgatgatggcggcgtattaattctgcccgtgggtgaagaaaatcagacattgcag
cgggtcacacggcgtggtgatgagtttatcgcagagacgatcgaagctgtacgctttgtc
ccgctggtgaaaggcgaactcgcctga

DBGET integrated database retrieval system