KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0819Help
Entry
Rahaq2_0819       CDS       T01770                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
860166..860885
Genome map
AA seq 239 aa AA seqDB search
MKKGLMLLTLLAACMSSAVHADEAAIKATLGKLGMSHAGIQPSPVTGLSAVSTDSGTLYI
TDDGKHVLQGPLYDVSGSHPVNVTNKTLVKKMDALQNEMIIYKAKNEKHVITVFTDITCG
YCHKLHQQMQDYNDLGITIRYLAFPRQGLNSKTEKDMQSIWCTGNRKTNFDAAMRGDDIT
PATCKTSDIAKHFELGVQFGVTGTPAIVLEDGTLIPGYQPPKEMAAMLDQQDPSHKTGG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttaatgctgctgacacttctggctgcgtgtatgagttccgcggtccat
gctgacgaagcagcaatcaaagccacgttgggcaaactgggcatgagccatgccgggatc
cagccttcgccggtaaccggtttgagtgcggtctctaccgacagcggcaccctttacatt
accgacgacggcaagcacgttttgcagggcccgctgtatgacgtcagcggcagccatccg
gttaacgtcaccaacaaaacgctggtgaagaagatggatgcgttacaaaacgagatgatc
atttataaagccaaaaacgaaaagcatgtgatcacggtgtttactgacatcacctgcggc
tattgccacaagctgcatcagcagatgcaggactataacgatcttggcataaccatccgt
tatctggccttcccgcgtcaggggctgaattccaaaaccgagaaagacatgcagtcgatc
tggtgtacaggcaaccgcaaaaccaactttgatgcggcaatgcgtggcgatgacatcacg
cctgctacctgcaaaaccagtgatattgcgaaacactttgagctgggcgttcagttcggc
gtgacaggcactccggccatcgtgctggaagacggaacgttgatccctggttatcagccg
ccaaaagaaatggccgccatgctcgaccagcaggatccttcacataaaaccggtggttga

DBGET integrated database retrieval system