KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0930Help
Entry
Rahaq2_0930       CDS       T01770                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:raq00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
972371..973567
Genome map
AA seq 398 aa AA seqDB search
MKKMTILGSTGSVGTSTLSVVRSNPDDFSVKALVAGRNVDVMAQQCLEFHPAYASMADES
SARALRAILAEQGSRTEVLSGPDAATELAALDDVDQVMSSIVGAAGLLPTLAAVRAGKQV
LLANKESLVTCGRIFMDAVRQSQSQLLPIDSEHNAIFQSLPESVQRQLGYASLKSHGISR
IILTGSGGPFRELPLDKFRDVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAAEMEVIIHPQSVIHSMVRYCDGSVLAQLGSPDMRTPIAHAMAYPRRVRTEVEALDFC
KMGAMTFSAPDYARYPCLQLAIEASNTGQAATTALNAANEISVAAFLNGEIRFTDIAFLN
RQVMEQLVSAEPDSVEEVLEIDAQARASAREKLHTFAL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgactattcttggttcgacagggtctgtcggcaccagtacgctttccgtt
gtccggtctaatcctgacgacttctccgttaaagcactggttgcagggcgcaatgttgac
gttatggcgcagcagtgccttgagtttcaccctgcatacgcttcgatggcggatgaatct
tctgcccgtgcgctgagagccattctggctgaacagggaagccgtaccgaggtgctttcg
ggccctgatgctgcgactgaactggctgctcttgatgatgtagatcaggtgatgtcgtct
atagtgggtgctgcgggcttgttaccgacactcgccgctgtgcgcgcaggtaaacaggtt
cttctggcgaacaaagaatcgctggtgacctgcgggcgcatttttatggatgctgtccgc
cagagccagtctcagctattgcccatcgacagtgaacacaatgcaattttccagagtttg
cctgaatccgttcagaggcaattgggatatgcttccctcaaaagccatgggatctcacgt
attattttaaccggatccggtggtccgttccgcgaattgccgttggataaattccgcgat
gtcactcctgatcaggcttgcgcgcaccccaactggtcgatggggcgtaaaatttccgtc
gactcggcaaccatgatgaacaaagggctggagtatattgaagcccgctggttgtttaat
gcctctgctgctgaaatggaagtgattatccatccgcaatccgtgatccattccatggtg
cgttattgcgatggcagcgtgctggctcaactgggatcgccggatatgcgcaccccgatt
gcgcatgctatggcatacccgcgcagagtcagaaccgaagtcgaagccctggatttttgt
aaaatgggtgcgatgactttcagcgctccggattatgcccgttatccttgcttgcaactt
gctatcgaagccagcaacaccgggcaggcagcgacgacggcactgaatgccgcgaatgaa
atttcagtggccgcgttcctcaatggcgagattcgttttaccgacattgctttcctgaat
cgtcaggtgatggagcagttagtgagtgctgaacctgattctgttgaagaagtgttggag
atagacgcacaggcgagagccagcgcacgtgagaaacttcatacatttgcgctataa

DBGET integrated database retrieval system