KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_1015Help
Entry
Rahaq2_1015       CDS       T01770                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rahaq2_1015
Enzymes [BR:raq01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Rahaq2_1015
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Rahaq2_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1052809..1053354
Genome map
AA seq 181 aa AA seqDB search
MSALTIFSDQDPCAPLWESRDGDAIAAELSKIDVRFERWQADRDLGENPQPQDVIAAYQH
EIDKLVEEKGYQSWDVISMRPDNEQREVLRTKFLSEHTHGEDEVRFFVEGAGLFCLHLNG
KIFQILCEKNDLISVPANTRHWFDMGGSPSFTAIRVFDNPEGWVAHFTGDKIADAYPRMG
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcattaacgatttttagtgaccaggatccttgcgcaccgttgtgggaaagccgc
gacggcgacgcgatcgccgccgaactgagcaaaattgatgtgcgtttcgaacgctggcag
gctgaccgcgatttaggcgagaacccgcagccgcaggacgtgattgctgcttatcagcat
gagatcgacaaactggtcgaagagaagggctaccagagctgggacgtgatcagcatgcgt
ccggacaacgagcaacgcgaggtgctgcgcactaaattcctgtccgaacatacgcacggt
gaagacgaagtgcgtttctttgttgaaggcgcagggctgttctgcctgcatctgaacggc
aagattttccagatcctgtgcgagaaaaacgatctgatttccgtaccggccaacacccgc
cactggtttgatatgggcggctctccgtcattcaccgcaatccgcgttttcgataatccc
gaagggtgggtggcgcattttaccggcgataagattgccgatgcgtacccgagaatgggt
gagtaa

DBGET integrated database retrieval system