KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_1063Help
Entry
Rahaq2_1063       CDS       T01770                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:raq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rahaq2_1063
Enzymes [BR:raq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Rahaq2_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1102155..1104209
Genome map
AA seq 684 aa AA seqDB search
MKINSREDIVHLLTSWVECGWLRELDRALVTFLAKEAPDAHPLLLLATALTSYQLGRGHV
CLDLQATLDDSAFSLSLPPEGDHADGAVIRPAAVLDSLSLQEWLAALAHPTLVGHGEGNS
PLVLTGQRLYLRRYWQYEQNVRAAIEQRLARSALHTLPAKALRAPLTALFPADGQSAITN
WQKLACALAAGSAFSIITGGPGTGKTTTVVRLLALLQTLALEENGQPLRIRLAAPTGKAA
ARLNESIAGAVSKLDLSALGNGDAVRESINTDVVTLHRLLGSRPDTRHFRHHPGNPLMVD
VLVVDEASMVDLEMMAALLAALPEQARLILLGDKDQLASVEAGALLSELCQRANGGHYLP
QTRDWLQSVTGEQIPDALVDPQGTAMDQAVVMLRHSYRFDAQSGIGQLAEAVNDGDVKAL
KQVWKHGYADLAQLTLSADDDTVLRDWVVKGGVKQFPATAKPEGAEPPAGYQHYLNVMIR
ERPADDEPPEAFSRWATKVLLAYSQFQLLCALRGGRWGVEALNQRIADILRKEGLLKASI
GWYPGRPVLVTRNDYSQRLMNGDIGITLEIPHRLADGSVVPTLRVAFLAGDGTQDIRWVM
PGRLQAVETVFAMTVHKSQGSEFTHTALLLPENLSPILTRELIYTGITRARHWFSLGCVG
GINAVLPDAVKRRVLRASGLIENA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaacagccgtgaagatattgtgcatctgctgacgagctgggtggaatgtggc
tggctgcgcgaactggatcgcgcactggtaacgtttctggcgaaagaagcgccggatgcc
catccgttgctattactggccaccgcactgaccagctatcagctcgggcgcgggcatgtg
tgcctggatttgcaggctacactcgacgacagcgccttttcactttcgctgccgccggag
ggagatcatgctgacggcgcggtgatccgtccggcagcggtgctggactctctgagtctg
caggaatggctggcggcgctggcgcacccgacgctggtcgggcacggcgaagggaattcg
cccctggtgctgaccggccagcgcctgtatctgcgccgttactggcagtatgaacagaat
gtacgggcggcaattgaacagcgtctggcacgcagtgcgttgcacactttgccggcgaag
gccctgcgcgcgccgctcactgcgctgttcccggcagatgggcaatctgctatcactaac
tggcaaaaactggcctgcgcgctggcggcaggcagtgcgttcagcattattaccggcggg
ccgggcaccggtaaaaccaccacggttgtgcgtctgctggcgttgttacagacgctggcg
ctggaagaaaacggccagccgctgcgtatccggctggctgccccgacgggtaaggcggcg
gcgcgtctgaatgagtcgatagccggtgcggtatcgaagctggatctcagtgcgctcggc
aacggtgatgcggtgcgtgaaagtatcaacaccgatgtggtgacgctgcaccgtctgctc
ggcagccgccccgatacccgccatttcaggcatcatccgggcaatccgctgatggtggat
gtgctggtggtcgatgaagcatcaatggtcgatctggaaatgatggcagcattgctggcg
gcattgccggaacaggcgcgtctgatcctgctgggtgataaagatcagcttgcgtcggta
gaagcgggtgcattactgagcgagttatgccagcgcgccaacggtggccattatctgccg
caaacccgcgactggctgcaaagcgtgaccggcgaacagatccctgatgcgctggttgat
ccgcaaggtacggcgatggatcaggccgtcgtcatgctgcgccacagttaccgttttgat
gcacaaagcggaatcggccagttggccgaagccgtaaatgacggtgatgtgaaagcgctg
aaacaggtctggaaacacgggtacgctgatctggcgcaactgacactgagtgcggatgat
gacaccgtactgcgcgactgggtggtgaagggcggagtgaagcagttcccggcgacggca
aaacctgagggtgcagaaccaccggccggctatcaacattatctcaatgtgatgatcagg
gagcgaccggcagacgatgaaccgccggaagcgttcagtcgctgggcaaccaaagtgctt
ctggcctatagccagttccagttgctgtgcgccttacgcggcgggcgctggggcgtggaa
gcgctgaatcagcgcatcgctgacattttgcgaaaagaaggattgcttaaggcgtcgatc
ggctggtatccggggcgtccggtgctggtgacccgcaatgattacagccagcgcctgatg
aacggcgatatcggcatcacgctggagatcccgcatcgtctggccgacggttctgtcgtg
ccgacccttcgggtggcatttctggccggagacggcacacaggatatccgctgggtgatg
ccgggacgcttgcaggcagtggaaacggtatttgccatgacggtgcataaatcgcaggga
tcagaatttacccataccgcgctgctgctgccggagaatctcagcccgatcctgacgcgc
gagctgatttacaccggtattacccgtgcgcgtcactggttcagtctgggatgtgtcggg
ggaataaatgccgttttaccggatgcggtgaagcgtcgggtgttacgtgccagcggatta
atcgaaaacgcgtaa

DBGET integrated database retrieval system