KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_1208Help
Entry
Rahaq2_1208       CDS       T01770                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:raq01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:raq00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:raq00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:raq00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:raq00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:raq00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1250576..1251541
Genome map
AA seq 321 aa AA seqDB search
MTKYSLVGDVGGTNCRLALCALDSGEISQSKTFSGLDYDSLEAVVREYLAQQHQDVEDAC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGLQHLEVINDFTAVSMAIPMLKEDDLLQFG
GKKAQDGKPAVIYGAGTGLGVAHLIHANNQWLSLPGEGGHVDFAPNSEEEDIILEQLRTE
LGHVSAERILSGPGLVNLYRAIVKSDNRVPENFRPKDVTELALTDENLDCRRALSLFCVI
MGRFGGNLALNMGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFKDYLMDIPVFLIT
HDQPGLLGAGAYLRQSIGMTI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagtactccctggtgggcgatgtcgggggcaccaactgccgcctggcgctttgc
gcgttggacagcggcgagatttctcagtctaagactttctccgggctggattacgacagc
ctcgaagccgtggtgcgtgagtacctcgcgcagcagcatcaggatgttgaagatgcctgt
attgccatcgcctgcccgatcaccggcgactgggtggccatgaccaaccatacgtgggcc
ttttccattgccgaaatgaagaaaaacctcggtctgcaacatctggaagtgatcaacgat
ttcactgccgtttctatggcaatcccgatgctgaaagaagatgacctgttgcagttcggc
ggtaaaaaagcgcaggacggcaaaccggcagtcatttacggtgcgggcaccgggctgggc
gtggcgcacttaatccatgccaataaccaatggctgagcctgccgggcgagggcggtcac
gttgatttcgcgccaaacagtgaagaagaagacatcattcttgagcagttgcgtaccgaa
ttgggacacgtttctgctgagcgtattctctccggtccgggcctggtgaatctctaccgt
gccatcgtcaaatcagataaccgcgtaccggaaaacttcagaccaaaagacgtgactgag
ctggcactgacggatgaaaatctggactgccgccgcgcactgtcactgttttgcgtcatc
atgggacgttttggcggcaatctggcgctgaacatggggaccttcggcggcgtatacatt
gcaggcggcatcgttccgcgcttcctggaattcttcaaagcctcgggctttcgcgccgcg
tttgaagataaaggtcgcttcaaagattacctgatggatattccggtattcctgatcacc
cacgatcaaccgggattactcggggcaggggcttatttgcgtcagtctatcggcatgaca
atctag

DBGET integrated database retrieval system