KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_1539Help
Entry
Rahaq2_1539       CDS       T01770                                 

Definition
phage-related lysozyme (muraminidase)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
Enzymes [BR:raq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Rahaq2_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1626419..1626928
Genome map
AA seq 169 aa AA seqDB search
MNSIVKRCSVAVVLALAALMPDYRFVKTSAEGLAIIANLEGCRLNPYQCSAGVWTSGIGH
TAGVKPAQNITEQDTARNLIADIIMTERAVDKCMPVTMPQPVYDAVISLAFNVGTGAACK
STLAYFIRHGEWSQACQQLPRWVYVNGVWNKGLNNRRAVELKHCMKGVP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaatcgttaaacgttgcagtgtggccgtcgtgttggcactcgccgcgctgatg
cctgattaccggtttgtcaaaacctccgccgagggtctggccattattgccaaccttgaa
gggtgccgcctgaatccgtaccagtgcagtgccggagtctggacgtcaggcattggccac
actgctggggtgaagcccgcgcagaacattacggagcaggacaccgcccgtaatctgatc
gctgacatcatcatgacggagcgtgccgtggataaatgtatgccggtgaccatgccgcag
ccggtgtatgacgccgtgatcagtctggcgtttaacgtcggtacgggagcggcatgtaaa
tccacgctggcttatttcatcaggcacggtgaatggtcgcaggcctgccagcagcttccc
cgctgggtgtatgtcaatggcgtgtggaataagggactcaacaaccgccgggctgttgaa
ctgaaacattgcatgaagggggtgccatga

DBGET integrated database retrieval system