KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_1654Help
Entry
Rahaq2_1654       CDS       T01770                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rahaq2_1654
Enzymes [BR:raq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Rahaq2_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1750292..1752361
Genome map
AA seq 689 aa AA seqDB search
MTKFPLLSSKISGLLHGADYNPEQWLESPDVLIRDVEMMKEARCNVMSVGIFSWSALEPE
EGHFTFGWMDQVLDRLHEHGISVFLATPSGARPAWMSQKYPEVLRVGRDRVKALHGGRHN
HCMSSPVYAEKVQLMNSALAKRYARHPAVIGWHISNEYGGECHCNYCQERFRDWLKARYV
TLDALNKAWWSAFWSHTYTDWAQIESPSPQGESGVHGLNLDWRRFNTDQVTRFCSEEIRP
LKAENPALPATTNFMEYFYDYDYWKLASVLDFISWDSYPMWHTRQDDIGLAAYTAMYHDL
MRTLKQGQPFVLMESTPSFTNWQPVSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
SEKFHGAVVDHVGHIDTRVGREVAELGGILSALAPVAGSRVEARVAIIFDWESRWAMDDS
LGPRNEGLEYENTVAGHYRALWAQGIAVDVINADCDLTGYDLVIAPMLYMVRAGVGERIT
AFVQAGGRFVATYWSGIVNETDLCFLSGFPGPLRPVLGIWAEEIDSLTDDQHNSVSGTEG
NALGLNGPYRASELCEVIHLEGAAALATYGDDFYAGTPAVTVNLFGKGQAYYLASRNDQQ
FHADFYSALAKEMKLPKAIDTELPEGVTAARRTDGESEFIFLQNYAADSQTVTLPDDYRD
MVHGGILPRKLTLPAFGCQILSRRLSVIA
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaatttcctcttctgagcagtaagatttccggcctgttacatggcgcggattac
aacccggaacagtggctggaaagccccgacgtactgattcgcgatgtcgaaatgatgaaa
gaggcacgctgtaatgtcatgtcagtcgggattttcagctggtcagcgctggaacctgaa
gaaggccacttcacgtttggctggatggatcaggtgctggaccgtttacatgaacacggt
atctcggtctttctcgccaccccaagcggggcgcgcccggcgtggatgtcacaaaaatat
ccggaagtcctgcgcgtgggccgtgaccgtgtgaaagcgctgcacggcgggcgtcacaac
cactgcatgagttcgccggtgtatgccgaaaaagtgcaactaatgaacagcgcgctggcg
aagcgctatgcccgtcatccggcggtgatcggctggcatatctccaatgaatacggcggc
gaatgtcattgcaactactgtcaggaacgtttccgcgactggctgaaagcgcgctatgtc
acgctcgatgcgctgaataaagcctggtggagcgccttctggagtcatacgtataccgac
tgggcacagattgaatcgccgtcaccgcagggcgaaagcggtgttcatggcctgaacctc
gactggcgtcgttttaacaccgatcaggtgacccgtttttgcagcgaggaaatccgtccg
ctgaaagcggagaatccggcgttaccggcgaccaccaatttcatggaatatttctacgat
tacgattactggaaactcgccagcgtgctggatttcatctcgtgggacagttacccgatg
tggcacacccgtcaggacgatatcggtctggcagcgtacaccgcgatgtaccacgacctg
atgcgcaccctgaaacaggggcagccgtttgtgctgatggaatcgacaccgagtttcacc
aactggcagccggtcagcaaactgaaaaagccgggcatgcatattctgtcttccctgcag
gcggtcgcgcacggtgcggattcggtgcagtatttccagtggcgtaaaagccgcggttct
tcggagaaattccacggcgcggtggtcgatcacgtcgggcatattgatacccgtgtcggg
cgcgaagtggccgaactgggcgggattttatcggctctggctccggtggcaggcagccgc
gtggaagccagagtggcgattatctttgactgggaaagccgctgggcgatggacgactcc
ctcgggccgcgtaatgaagggctggagtatgaaaataccgtcgccggacattaccgcgcg
ctgtgggcgcagggcattgcggtcgatgtgatcaatgccgattgcgatttaaccggttat
gacctggtgattgcgccgatgctgtatatggtgcgcgcaggcgtcggcgagcggatcacc
gcgtttgtgcaggccggtgggcggtttgtcgcgacttactggagcggcattgttaacgaa
acggacctgtgtttcctcagcggattccccggaccgttgcgtccggtgctgggtatctgg
gcggaagaaatcgacagcctgactgacgaccagcacaacagcgtcagcggcaccgaaggc
aatgcactgggcttaaacggcccgtaccgtgccagcgaattgtgtgaagtgatccatctg
gaaggcgcggcggcgctggcaacttacggtgatgacttctatgccggaacgccagccgtg
accgtgaatctgtttggcaaagggcaggcgtattatctggcctcgcgcaatgatcagcag
ttccacgctgatttttatagcgcgctggccaaagagatgaaactgccgaaggcgatagat
accgaactgccggaaggcgtcactgcagcacgccgcaccgacggggaaagtgaatttatc
ttcctgcaaaactacgcggcagacagccagacagtgacgctgccggacgattatcgcgac
atggtgcacggcggtatattaccgcgcaagctgacgctgccggcgtttggttgtcagatc
ctgtcgcgccgcttatccgttattgcttaa

DBGET integrated database retrieval system