KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_1797Help
Entry
Rahaq2_1797       CDS       T01770                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:raq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rahaq2_1797
Enzymes [BR:raq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Rahaq2_1797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1895592..1896206
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETNGVGYEVHMPMTCFYELPELGQEAIIFTQFIVREDAQLL
YGFNDKQERALFRELIKVNGVGPKLALAILSGMSAQQFVSAVEKEEITALIKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNNHTDITLPASASKAKESDAEGEAVAALISLGYKPPEASR
MISKVAKPGAESETLIREALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactacgaggcattattctggaaaaacagccccctttggtgctgcttgaa
accaacggcgtgggctatgaagtgcatatgccgatgacctgtttttatgaattgccggaa
ctgggtcaggaagctatcatcttcacgcaatttatcgtccgtgaagatgctcagttgctc
tacggattcaacgataaacaagagcgcgcgctgttccgtgagctgattaaagtcaacggc
gtcgggccgaagctggcgctggcaatcctctcaggtatgtcggcacagcagtttgtcagt
gcggtagaaaaggaagaaatcaccgcattaattaagttacccggcgtcggtaagaaaacc
gcagaacgcctcgttgtcgaaatgaaagaccggtttaaaggattaaacggtgatctattt
aacaatcatactgatatcacgctacctgcatcggcgtcgaaagctaaagagtctgatgcc
gaaggcgaagccgtcgcagccctgatatccctcggatacaaacccccggaagccagccgc
atgatcagcaaagtggcgaagccgggtgcagaatctgaaacgttaattagagaagcgctg
cgcgcggcgctgtga

DBGET integrated database retrieval system