KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_1830Help
Entry
Rahaq2_1830       CDS       T01770                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rahaq2_1830
   00052 Galactose metabolism
    Rahaq2_1830
   00500 Starch and sucrose metabolism
    Rahaq2_1830
   00520 Amino sugar and nucleotide sugar metabolism
    Rahaq2_1830
Enzymes [BR:raq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rahaq2_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1932885..1933772
Genome map
AA seq 295 aa AA seqDB search
MLKAVIPVAGLGTRMLPATKAIPKEMLPIVDKPLIQYIVNECAAAGIKEIILVTHSSKNA
IENHFDTSFELESMLESRVKRQLLEEVQSICPKGVTIMNVRQGQSKGLGHAVLCAKPLIG
NSPFAVILPDVLMDDSTSDLRKDNLAAMLRRFQETGNSQVMVEEVPEKDVSKYGIVNCNG
VEVEPGESAPMTAIVEKPELKDAPSNLAVVGRYVLSEAIWPLLAVTPYGAGNEIQLTDAI
AMLMKKHTVEAFSMTGRSHDCGDKLGYMKAFVEYGIRHNSQGEAFKAWLKEFAEE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagctgttatccctgttgccggtctgggcacacgtatgttgccagcgacgaaa
gccattccaaaagaaatgctgcctatcgtcgataagcctttgattcagtacatcgttaat
gaatgtgctgcggcgggcatcaaagaaatcattctggtcacgcactcttcgaaaaacgcg
atcgagaaccacttcgatacctctttcgagctggaaagtatgctcgaatcccgtgtgaaa
cgtcagttgctggaagaagtacagtctatctgcccgaaaggcgtgaccatcatgaacgtg
cgtcaggggcaatcaaaaggcctcgggcatgcggttctgtgtgcaaaacctctgattggt
aattctcctttcgcggttattctgcctgacgttctgatggatgattccaccagcgatctg
cgtaaagataacctggctgccatgcttcgccgtttccaggaaactggcaacagccaggtc
atggttgaagaagtgccggaaaaagatgtttccaagtacggtattgttaactgcaacggt
gtagaagttgagccgggtgaaagcgctccgatgactgctatcgttgaaaaaccagagctc
aaagacgcgccatccaacctcgcggttgttggccgttatgttctgtctgaggctatctgg
ccattactggcagtgacgccgtacggtgcgggtaacgaaatccagctgacagatgccatt
gcgatgctgatgaaaaaacatactgttgaagccttctccatgaccggccgttcacatgac
tgcggtgataagctcggttatatgaaagcgtttgttgagtatggtattcgccataactcg
cagggcgaagcgttcaaggcgtggttgaaagagtttgctgaagagtag

DBGET integrated database retrieval system