KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_1877Help
Entry
Rahaq2_1877       CDS       T01770                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:raq00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rahaq2_1877
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rahaq2_1877
Enzymes [BR:raq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rahaq2_1877
Two-component system [BR:raq02022]
 CheA family
  CheA-CheYBV
   Rahaq2_1877
Bacterial motility proteins [BR:raq02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rahaq2_1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1984298..1985347
Genome map
AA seq 349 aa AA seqDB search
MNKIRVLSVDDSALMRQLMTEIINSHPDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEITLRALELGAIDFVTKPQLGIREGMLAYS
EMIADKIRTASKARLNKSVNIDQPRILSHTPLLSSEKLIAIGSSTGGTEAIRHVLQPLPP
TCPALMITQHMPPGFTRSFADRLNKLCQITVKEAEDGERVLPGHAYIAPGDRHMELVRSG
ANYQVKLNDGPAVNRHRPSVDVLFRSVAQFAGRNAVGVILTGMGNDGAAGMLEMHRAGAY
TLAQNEASCVVFGMPREAIAAGGVNEVVDLSQISQRMLAQISAGQALRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatcagagtattgagcgtcgatgattcggcgttaatgcgtcagctgatgact
gaaatcatcaacagccatccggatatggaaatggtggcgaccgcccccgatccgctggtg
gcgcgcgatcttatcaaaaaattcaacccggacgtgctgacgctggatgttgaaatgccg
cgcatggacggcctggattttctcgaaaaactgatgcgtctgcgtccgatgccggtggtg
atggtgtcctcgctgaccggtaaaggctcggaaattaccctgcgggcactggaacttggc
gcgattgattttgtgaccaaaccgcaactggggatccgcgaaggcatgctggcctacagc
gagatgattgccgataagatccgcacggcgtcaaaagcgcgtctgaacaaaagcgtcaac
attgatcagccgcgcattctcagccatacgccgttgctgagcagcgaaaagctgattgct
atcggctcatcaacgggcggcacagaggctatccgccacgtgctgcaaccgctgccgcca
acctgtccggcgctgatgatcacccagcacatgccgccggggtttacccgttctttcgcc
gatcgtctgaacaagttgtgtcagatcacggtgaaagaagcagaagacggtgagcgtgtt
ctgccgggtcatgcgtatatcgcaccgggcgacaggcatatggaactggtacgcagtggt
gccaactatcaggttaagttgaacgacggtccggcggtgaaccgccatcgtccgtcggtc
gacgttttattccgttcggtggcgcagttcgccggacgcaatgccgtcggggtgatcctg
acgggtatgggcaatgacggcgccgccggcatgcttgagatgcaccgggcaggggcttac
acccttgcacaaaacgaagccagctgtgtggtgttcggtatgcctcgtgaggctatcgcc
gcaggtggcgtaaacgaagtggtggatctcagccaaatcagccagcggatgctggcgcaa
atatcagccggtcaggcattacgtatttaa

DBGET integrated database retrieval system