KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2055Help
Entry
Rahaq2_2055       CDS       T01770                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00260  Glycine, serine and threonine metabolism
raq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
raq01100  Metabolic pathways
raq01110  Biosynthesis of secondary metabolites
raq01130  Biosynthesis of antibiotics
raq01230  Biosynthesis of amino acids
Module
raq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:raq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rahaq2_2055
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rahaq2_2055
Enzymes [BR:raq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rahaq2_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEX51916
UniProt: H2IX38
Position
complement(2158948..2160138)
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGEFGGQYVPQILMPALAQLEEAFVSAQRDPEFQAEFIDLLKNYAGRPTALTL
CKNLTVGTKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGSY
EKAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQMQEREGCLPDAVIACVGGGSNAIGMF
ADFIDDTSVKLIGVEPGGLGIETGQHGAPLKHGHVGIYFGMKAPMMQTSEGQIEESYSIS
AGLDFPSVGPQHAFLNSIGRAEYVSITDDEALEAFKELSRNEGIIPALESSHALAYALKL
IKETPEKEQILVVNLSGRGDKDIFTVHDILTARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgactttacttaatccctacttcggcgaatttggcggccagtatgttccgcaaattctg
atgcctgcgctggcccagctcgaagaggcttttgtcagcgcgcagcgcgaccctgagttt
caggctgaattcattgatctgctgaaaaactatgccggccgcccgacagcactgacgctg
tgcaaaaacctgaccgtcggaaccaaaaccaggctgtatcttaaacgtgaagatttgctg
cacggcggcgcgcacaaaactaaccaggtgttgggtcaggcattgcttgccaaacgtatg
ggcaaaactgaaattatcgccgaaaccggcgcggggcagcatggcgtggcatcggcactg
gcctgtgccctgctcggcctgaaatgccgcatttatatgggcgcaaaagacattgaacgt
cagtcgccaaacgtgttccgtatgcgtctgatgggggctgaagtcattcctgtacacagc
ggttcttctacgctgaaagatgcctgtaatgaggcactgcgcgactggtccggcagctat
gaaaaagcccactatatgctgggcacggcggcgggcccgcatccttatccgaccatcgtg
cgtgaattccagcgtatgatcggcgaagaaactaaagcacagatgcaggaacgcgaaggc
tgtctgccggatgccgttattgcctgcgtcggtggcggctccaatgcgatcggtatgttt
gccgatttcatcgacgacaccagtgtgaaactgatcggcgttgaacctggcggtctgggc
atcgaaaccggacaacacggcgcaccactgaaacatggtcacgttggcatttacttcggc
atgaaagcgccgatgatgcagacctctgaaggtcagatcgaagaatcgtattccatttct
gccggtctggatttcccgtctgtaggcccgcaacacgccttcctcaacagcattggccgt
gcagaatatgtctccattaccgatgatgaggcgctggaagcctttaaagagttgtcccgc
aatgaagggattattccggcgctggaatcctctcatgcgctggcttacgcgctgaaactg
atcaaggaaacaccagaaaaagaacagattctggtcgtgaacctgtccggccgcggcgat
aaagacattttcaccgtacacgacatcctgactgcccggggagagatttaa

DBGET integrated database retrieval system